Active Recombinant Human IGFBP1 Protein
Cat.No. : | IGFBP1-143H |
Product Overview : | Recombinant Human IGFBP1 was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Bio-activity : | ED50 was determined by its ability to inhibit IGF-I induced proliferation of MCF-7 is less than or equal to 0.5 ug/mL in the presence of 6 ng/ml of human IGF-I. |
Molecular Mass : | 25.4 kDa |
AA Sequence : | MAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | IGFBP1 insulin-like growth factor binding protein 1 [ Homo sapiens ] |
Official Symbol | IGFBP1 |
Synonyms | IGFBP1; insulin-like growth factor binding protein 1; IBP1; insulin-like growth factor-binding protein 1; AFBP; alpha pregnancy associated endometrial globulin; amniotic fluid binding protein; binding protein 25; binding protein 26; binding protein 28; growth hormone independent binding protein; hIGFBP 1; IGF binding protein 1; IGF BP25; placental protein 12; PP12; IBP-1; IGFBP-1; binding protein-25; binding protein-26; binding protein-28; IGF-binding protein 1; growth hormone independent-binding protein; alpha-pregnancy-associated endometrial globulin; IGF-BP25; hIGFBP-1; |
Gene ID | 3484 |
mRNA Refseq | NM_000596 |
Protein Refseq | NP_000587 |
MIM | 146730 |
UniProt ID | P08833 |
◆ Recombinant Proteins | ||
IGFBP1-1081C | Recombinant Chicken IGFBP1 | +Inquiry |
IGFBP1-300R | Recombinant Rhesus macaque IGFBP1 Protein, His-tagged | +Inquiry |
Igfbp1-3083R | Recombinant Rat Igfbp1 protein, His-tagged | +Inquiry |
Igfbp1-3082M | Recombinant Mouse Igfbp1 protein, His-tagged | +Inquiry |
Igfbp1-988R | Recombinant Rat Igfbp1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IGFBP1-612H | Native Human Insulin-like Growth Factor Binding Protein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFBP1-1482CCL | Recombinant Cynomolgus IGFBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFBP1 Products
Required fields are marked with *
My Review for All IGFBP1 Products
Required fields are marked with *
0
Inquiry Basket