Active Recombinant Human KLK11 Protein (232 aa)

• Cat.No.: KLK11-140K
• Product Overview: Recombinant human Kallikrein-11(rhKLK-11) secreted in Sf9 insect cells is a single glycosylated polypeptide chain containing 232 amino acids. A fully biologically active molecule, rhKallikrein-11 has a molecular mass of 35.0 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: Sf9 Cells
• Protein Length: 232
• Description: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Kallikrein-11 (KLK-11) is possible multifunctional protease.KLK11 efficiently cleaves 'bz-Phe-Arg-4-methylcoumaryl-7-amide', a kallikrein substrate, and weakly cleaves other substrates for kallikrein and trypsin. Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: KLK-11 specific activity is > 2000 pmole/min/μg when measured by 100uM colormetric peptide substrate (D-Val-Leu-Lys-ThioBenzyl ester).
• Molecular Mass: 35.0 kDa, observed by reducing SDS-PAGE.
• AA Sequence: EFAATMLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAHHHHHHGSGSDDDDKETRIIKGFECKPHSQPWQAALFEKTRLLCGATLIAPRWLLTAAHCLKPRYIVHLGQHNLQKEEGCEQTRTATESFPHPGFNNSLPNKDHRNDIMLVKMASPVSITWAVRPLTLSSRCVTAGTSCLISGWGSTSSPQLRLPHTLRCANITIIEHQKCENAYPGNITDTMVCASVQEGGKDSCQGDSGGPLVCNQSLQGIISWGQDPCAITRKPGVYTKVCKYVDWIQETMKNN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human Kallikrein-11(rhKLK-11) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhKLK-11 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS, pH7.4
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: KLK11 kallikrein-related peptidase 11 [ Homo sapiens ]
• Official Symbol: KLK11
• Synonyms: KLK11; kallikrein-related peptidase 11; kallikrein 11, PRSS20; kallikrein-11; TLSP; hK11; hippostasin; kallikrein 11; serine protease 20; trypsin-like protease; PRSS20; MGC33060
• Gene ID: 11012
• mRNA Refseq: NM_001136032
• Protein Refseq: NP_001129504
• MIM: 604434
• UniProt ID: Q9UBX7