Active Recombinant Human NTF4 Protein (131 aa)
Cat.No. : | NTF4-324N |
Product Overview : | Recombinant human Neurotrophin-4 (rhNT-4) produced in E. coli is a noncovalently linked homodimer containing two non-glycosylated polypeptide chains of 131 amino acids. A fully biologically active molecule, rhNT-4 has a molecular mass of 28.1kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 131 |
Description : | Neurotrophin-4 (NT-4), also known as NT-5, is a neurotrophic factor structurally related to β-NGF, BDNF, and NT-3. Human NT-4 shares 48 - 52% aa sequence identity with human β-NGF, BDNF, and NT-3.Neurotrophins have six conserved cysteine residues that are involved in the formation of three disulfide bonds. NT-4 is expressed highest levels in prostate, lower levels in thymus, placenta, and skeletal muscle. NT-4 binds and induces receptor dimerization and activation of TrkB. NT-4 can signal through TrkB receptors and promotes the survival of peripheral sensory sympathetic neurons. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 5.0 μg/mL, measured by a cell proliferation assay using C6 cells, corresponding to a specific activity of > 2.0 × 10^2 units/mg. |
Molecular Mass : | 28.1 kDa, a noncovalently linked homodimer,of two 14.0 kDa polypeptide monomers. |
AA Sequence : | MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA |
Endotoxin : | < 0.3 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant human Neurotrophin-4 (rhNT-4) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhNT-4 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 50mM acetic acid. |
Reconstitution : | Reconstituted in 50mM acetic acid or ddH2O at 50 μg/mL. |
Gene Name | NTF4 neurotrophin 4 [ Homo sapiens ] |
Official Symbol | NTF4 |
Synonyms | NTF4; neurotrophin 4; neurotrophin 5 (neurotrophin 4/5), NTF5; neurotrophin-4; GLC1O; neurotrophic factor 4; NT 4/5; neurotrophin-5; neutrophic factor 4; neurotrophic factor 5; neurotrophin 5 (neurotrophin 4/5); NT4; NT5; NT-4; NT-5; NTF5; GLC10; NT-4/5; |
Gene ID | 4909 |
mRNA Refseq | NM_006179 |
Protein Refseq | NP_006170 |
MIM | 162662 |
UniProt ID | P34130 |
◆ Recombinant Proteins | ||
NTF4-089H | Active Recombinant Human NTF4 Protein | +Inquiry |
NTF4-29H | Recombinant Human NTF4 | +Inquiry |
NTF4-219H | Recombinant Human NTF4 Protein | +Inquiry |
NTF4-3760R | Recombinant Rat NTF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
NTF4-4099R | Recombinant Rat NTF4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTF4-3669HCL | Recombinant Human NTF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NTF4 Products
Required fields are marked with *
My Review for All NTF4 Products
Required fields are marked with *
0
Inquiry Basket