Active Recombinant Human PDGFBB Protein (109 aa)
Cat.No. : | PDGFB-060P |
Product Overview : | Recombinant Human PDGFBB Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 109 |
Description : | Human Platelet-derived growth factor -BB Platelet-derived growth factor (PDGF) presenting in serum but absent from plasma was first discovered in animal study by Lynch and co-workers in the late 1980s. It is a disulfide-linked dimer consisting of two peptides-chain A and chain B. PDGF has three subforms: PDGF-AA, PDGF-BB, PDGF-AB. It is involved in a number of biological processes, including hyperplasia, embryonic neuron development, chemotaxis, and respiratory tubule epithelial cell development. The function of PDGF is mediated by two receptors (PDGFR-α and PDGFR-β). |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard.The ED50 as determined by the dose-dependent stimulation of the proliferation of murine Balb/c 3T3 cells is ≤ 3.0 ng/mL, corresponding to a specific activity of ≥ 3.3 × 10^5 units/mg. |
Molecular Mass : | Approximately 12.4 KDa, a disulfide-linked homodimeric protein containing two 109 amino acid residues polypeptide (B chain). |
AA Sequence : | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
Endotoxin : | Less than 1 EU/μg of rHuPDGF-BB as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20C. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | PDGFB platelet-derived growth factor beta polypeptide [ Homo sapiens ] |
Official Symbol | PDGFB |
Synonyms | PDGFB; platelet-derived growth factor beta polypeptide; platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog), SIS; platelet-derived growth factor subunit B; becaplermin; oncogene SIS; SSV; PDGF-2; PDGF, B chain; PDGF subunit B; proto-oncogene c-Sis; platelet-derived growth factor 2; platelet-derived growth factor B chain; platelet-derived growth factor, B chain; Platelet-derived growth factor, beta polypeptide (oncogene SIS); platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); SIS; PDGF2; c-sis; FLJ12858; |
Gene ID | 5155 |
mRNA Refseq | NM_002608 |
Protein Refseq | NP_002599 |
MIM | 190040 |
UniProt ID | P01127 |
◆ Recombinant Proteins | ||
PDGFB-516M | Active Recombinant Mouse PDGFB protein, His-tagged | +Inquiry |
Pdgfb-1931R | Recombinant Rat Pdgfb Protein, His&GST-tagged | +Inquiry |
PDGFB-168H | Active Recombinant Human PDGFB Protein, Biotinylated | +Inquiry |
PDGFB-528H | Recombinant Human PDGFB protein | +Inquiry |
PDGFB-377H | Active Recombinant Human PDGFB protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFB-1321HCL | Recombinant Human PDGFB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGFB Products
Required fields are marked with *
My Review for All PDGFB Products
Required fields are marked with *
0
Inquiry Basket