Recombinant Human Fibroblast Growth Factor 2 (basic) (aa 146)

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Fibroblast Growth Factor 2 (basic) (aa 146)

Recombinant Human Fibroblast Growth Factor 2 (basic) (aa 146)

FGF2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : FGF2-678H
Product Overview : Recombinant humanFibroblast Growth Factor 2 contains 146 amino acids.
Description : FGF2 hasbeen hypothesized that, during both wound healing of normal tissues and tumordevelopment, the action of heparan sulfate-degrading enzymes activates bFGF,thus mediating the formation of new blood vessels, a process known asangiogenesis.
Source : E. coli
Species : Human
Form : Lyophilized from a0.2 um sterile filtered solution, carrier free.
Purity : >95% asdetermined by SDS-PAGE analysis.
Molecular Weight : 17 kDa
Endotoxin Level : <0.1 ng/ug ofFGF2
Biological Activity : Determined by thedose-dependent proliferation of BALB/3T3 cells. The EDSO range is 0.1-1.0ng/ml.
Specific Activity : 1.0 x 107to 1.0 x 106 units/mg
Amino Acid Sequence : PALPEDGGSGIKLQLQAEERNNYNTYRSRK AFPPGHFKDPGWSIKGVCAYTSWYVALKRKRLYCKNGGFNRYLAMKEDGTGQYKLG SKT FLR旧PDGRV RLLASKCVTDGPGQKAILFL DGVREKSDPHECFFFELESPMSAKS
Reconstitution : Centrifuge vialprior to opening. Add sterile distilled water to the vial to fully solubilizethe protein to a concentration of 0.1-0.5 mg/ml. Further dilutions should bemade in medium or buffered solution containing carrier protein such as PBSwith 0.1%BSA. Please note that the addition of any carrier protein into thisproduct may produceunwanted endotoxin.This depends upon the particular application employed.
Storage : Store at -20°C to-80°C with a carrier protein (0.1%HSA or BSA) as a stabilizer for long termstorage. Please note that the addition of any carrier protein into thisproduct may produce unwanted endotoxin. This depends upon the particularapplication employed. Avoid repeated freeze-thaw cycles.
OfficialSymbol : FGF2
PDB renderingbased on 1bas. :

Gene Name : FGF2 fibroblast growth factor 2(basic) [ Homo sapiens ]
Synonyms : FGF2; fibroblastgrowth factor 2 (basic); BFGF; FGFB; HBGF-2; heparin-binding growth factor 2; prostatropin;OTTHUMP00000037513; basic fibroblast growth factor bFGF
Gene ID : 2247
mRNA Refseq : NM_002006
Protein Refseq : NP_001997
MIM : 134920
UniProt ID : P09038
Chromosome Location : 4q26
Pathway : Angiopoietinreceptor Tie2-mediated signaling; Downstreamsignaling of activated FGFR; EndochondralOssification; FGFR ligand binding andactivation; FGFR1 ligand binding andactivation; FGFR1b ligand binding andactivation; FRS2-mediated cascade;Glypican 1 network; IRS-mediated signalling; IRS-related events; Integrins in angiogenesis; MAPKsignaling pathway; Melanoma; PI-3K cascade; PI3KCascade
Function : chemoattractantactivity; cytokine activity; fibroblast growth factor binding; fibroblast growthfactor receptor binding; growth factor activity; heparin binding;ligand-dependent nuclear receptor transcription coactivator activity; proteinbinding; protein tyrosine kinase activity; voltage-gated calcium channelactivity

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.