| Cat.No. : | Exendin-4-01 |
| Product Overview : | Recombinant Heloderma Exendin-4 protein was expressed in Escherichia coli. |
| Description : | Exendin-4 is a novel 39-amino acid peptide isolated from the venom of the Gila monster Heloderma suspectum. It shares 53% sequence homology with GLP-17-36amide and interacts with the same membrane receptor. Exendin-4 enhances glucose-dependent insulin secretion, suppresses inappropriately elevated glucagon secretion, and slows gastric emptying in vivo. It also promotes ß-cell proliferation and neogenesis in vitro and in animal models. |
| Source : | E.coli |
| Species : | Heloderma |
| Form : | Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4. |
| Bio-activity : | 1. Regulates Glucose levels rapidly;2. Reduces Insulin resistance;3. Reduces Glucagon;4. Reduces HbA1c;5. Stimulates beta cell growth which stimulates insulin production. |
| Molecular Mass : | Approximately 4.2 kDa, a single non-glycosylated polypeptide chain containing 39 amino acids. |
| Protein length : | 39 |
| AA Sequence : | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Endotoxin : | Less than 10 EU/mg of rExendin-4 as determined by LAL method. |
| Purity : | >96% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| UniProt ID : | P26349 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All Exendin Products
Download Datasheet