"Exendin" Related Products

    Recombinant Heloderma Exendin-4 protein

    Cat.No. : Exendin-4-01
    Product Overview : Recombinant Heloderma Exendin-4 protein was expressed in Escherichia coli.
    Description : Exendin-4 is a novel 39-amino acid peptide isolated from the venom of the Gila monster Heloderma suspectum. It shares 53% sequence homology with GLP-17-36amide and interacts with the same membrane receptor. Exendin-4 enhances glucose-dependent insulin secretion, suppresses inappropriately elevated glucagon secretion, and slows gastric emptying in vivo. It also promotes ß-cell proliferation and neogenesis in vitro and in animal models.
    Source : E.coli
    Species : Heloderma
    Form : Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
    Bio-activity : 1. Regulates Glucose levels rapidly;2. Reduces Insulin resistance;3. Reduces Glucagon;4. Reduces HbA1c;5. Stimulates beta cell growth which stimulates insulin production.
    Molecular Mass : Approximately 4.2 kDa, a single non-glycosylated polypeptide chain containing 39 amino acids.
    Protein length : 39
    AA Sequence : HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
    Endotoxin : Less than 10 EU/mg of rExendin-4 as determined by LAL method.
    Purity : >96% by SDS-PAGE and HPLC analysis.
    Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
    Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
    UniProt ID : P26349

    Online Inquiry

    Note: There will be extra charge for optional service!

    Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

    Optional requirements on this protein    +Expand

    Price Inquiry

    Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.