Recombinant Human ACVR1
Cat.No. : | ACVR1-9172H |
Product Overview : | Recombinant Human ACVR1, was expressed in Baculovirus-Insect cells |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Non |
Protein Length : | 123 amino acids |
Description : | Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive. |
Form : | Lyophilized. 25 mM Tris-HCl, pH7.4, 300 mM NaCl ,1 mM DTT, 5%Trehalose |
Molecular Mass : | Has a calculated molecular mass of 13.5KDa. It migrates as an approximately 17kDa band in SDS-PAGE under reducing conditions. |
AA Sequence : | MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYE QGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE |
Purity : | >93% as determined by SDS-PAGE |
Storage : | Store it at +4℃ for short term. For long term storage, store it at -20℃ ~ -70℃ |
Reconstitution : | It is recommended to reconstitute the lyophilized ACVR1 in 0.1~0.2ml sterile and pre-cooled ddH2O, which can then be further diluted to other aqueous solutions. |
Gene Name | ACVR1 activin A receptor, type I [ Homo sapiens ] |
Official Symbol | ACVR1 |
Synonyms | ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI; |
Gene ID | 90 |
mRNA Refseq | NM_001105 |
Protein Refseq | NP_001096 |
MIM | 102576 |
UniProt ID | Q04771 |
Chromosome Location | 2q23-q24 |
Pathway | ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | ATP binding; SMAD binding; activin binding; contributes_to activin receptor activity, type I; follistatin binding; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transmembrane receptor protein serine/threonine kinase activity; |
◆ Recombinant Proteins | ||
ACVR1-0494H | Recombinant Human ACVR1 Protein (Ile208-Lys340), N-GST-tagged | +Inquiry |
ACVR1-246H | Active Recombinant Human ACVR1 Protein, GST-tagged | +Inquiry |
Acvr1-8719R | Recombinant Rat Acvr1 protein, hFc-tagged | +Inquiry |
ACVR1-201H | Active Recombinant Human ACVR1(R206H), GST-tagged | +Inquiry |
ACVR1-5680H | Recombinant Human ACVR1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1-3097HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
ACVR1-478HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
ACVR1-2686MCL | Recombinant Mouse ACVR1 cell lysate | +Inquiry |
ACVR1-967CCL | Recombinant Canine ACVR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVR1 Products
Required fields are marked with *
My Review for All ACVR1 Products
Required fields are marked with *