Recombinant Human ACVR1

Cat.No. : ACVR1-9172H
Product Overview : Recombinant Human ACVR1, was expressed in Baculovirus-Insect cells
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Non
Protein Length : 123 amino acids
Description : Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive.
Form : Lyophilized. 25 mM Tris-HCl, pH7.4, 300 mM NaCl ,1 mM DTT, 5%Trehalose
Molecular Mass : Has a calculated molecular mass of 13.5KDa. It migrates as an approximately 17kDa band in SDS-PAGE under reducing conditions.
AA Sequence : MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYE QGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE
Purity : >93% as determined by SDS-PAGE
Storage : Store it at +4℃ for short term. For long term storage, store it at -20℃ ~ -70℃
Reconstitution : It is recommended to reconstitute the lyophilized ACVR1 in 0.1~0.2ml sterile and pre-cooled ddH2O, which can then be further diluted to other aqueous solutions.
Gene Name ACVR1 activin A receptor, type I [ Homo sapiens ]
Official Symbol ACVR1
Synonyms ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI;
Gene ID 90
mRNA Refseq NM_001105
Protein Refseq NP_001096
MIM 102576
UniProt ID Q04771
Chromosome Location 2q23-q24
Pathway ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function ATP binding; SMAD binding; activin binding; contributes_to activin receptor activity, type I; follistatin binding; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transmembrane receptor protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACVR1 Products

Required fields are marked with *

My Review for All ACVR1 Products

Required fields are marked with *

0
cart-icon