| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
Among ubiquitin-conjugating enzymes, the mammalian ubiquitin conjugating enzyme UbcH1, also known as HIP2, is unique in its ability to catalyze the in vitro synthesis of unanchored Lys48-linked poly-ubiquitin chains from mono- or poly-ubiquitin, E1, and ATP. In addition, UbcH1 can catalyse the cyclization of longer poly-ubiquitin chains, including tetra- and penta-ubiquitin. Recombinant UbcH1 charges and supports ubiquitinylation in vitro. Typical enzyme concentration to support conjugation in vitro is 100nM to 1μM. Recently, HIP2 (or UbcH1) has been shown to bind to the N terminus of Huntington and may play a role in Huntington disease. |
| Amino acid sequence : |
MHHHHHHAMANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPD TPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLR TVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYT KKIENLCAMGFDAVIVALSSKSWDVETATELLLSN. |
| Physical Appearance : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Purity : |
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
| Formulation : |
Lyophilized from a 0.2 μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1 mM DTT, pH 7.5. |
| Solubility : |
It is recommended to reconstitute the lyophilized HIP-2 in sterile water not less than 100 µg/ml, which can then be further diluted to other aqueous solutions. |
| Stability : |
Lyophilized HIP-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UbcH1 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
