"FGFR2" Related Products

Recombinant Human FGFR2, His-tagged, Biotinylated

Cat.No.: FGFR2-607H
Product Overview: The recombinant human FGFR2 ECD protein is expressed as a 367 amino acid protein consisting of Arg22 - Glu377 region of FGFR2 (Uniprot accession #P21802 - isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 8 potential N-linked glycosylation sites.
Source: Human cells
Species: Human
Tag: His
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule)
Bio-activity: Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.
Molecular Mass: Calculated molecular mass (kDa): 40.9; Estimated by SDS-PAGE under reducing condition (kDa): ~65
AA Sequence: RPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIK GATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAV PAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHT YHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGV NTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDYLESTGHHHHHHHH
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: FGFR2 fibroblast growth factor receptor 2 [ Homo sapiens ]
Official Symbol: FGFR2
Synonyms: FGFR2; fibroblast growth factor receptor 2; bacteria expressed kinase , BEK, CFD1, craniofacial dysostosis 1 , Jackson Weiss syndrome , JWS, keratinocyte growth factor receptor , KGFR; CD332; CEK3; Crouzon syndrome; ECT1; K SAM; Pfeiffer syndrome; TK14; TK25; FGFR-2; FGF receptor; soluble FGFR4 variant 4; bacteria-expressed kinase; hydroxyaryl-protein kinase; keratinocyte growth factor receptor; BEK fibroblast growth factor receptor; protein tyrosine kinase, receptor like 14; BEK; JWS; CFD1; KGFR; BFR-1; K-SAM; FLJ98662;
Gene ID: 2263
mRNA Refseq: NM_000141
Protein Refseq: NP_000132
MIM: 176943
UniProt ID: P21802
Chromosome Location: 10q25.3-q26
Pathway: Angiogenesis, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR2 ligand binding and activation, organism-specific biosystem;
Function: ATP binding; fibroblast growth factor binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; heparin binding; nucleotide binding; protein binding; protein homodimerization activity; protein tyrosine kinase activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.