Recombinant Human INHA, GST-tagged INHA-512H

Recombinant Human INHA, GST-tagged

PRODUCTS

Home / Products / Recombinant Human INHA, GST-tagged

Recombinant Human INHA, GST-tagged

INHA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : INHA-512H
Product Overview : Recombinant Human INHA(1 a.a. - 366 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes the alpha subunit of inhibins A and B protein complexes. These complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : Theoretical MW (kDa): 66
AA Sequence : MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPE EEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP LLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPS GGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : INHA inhibin, alpha [ Homo sapiens ]
Official Symbol : INHA
Synonyms : inhibin alpha chain; A-inhibin subunit
Gene ID : 3623
mRNA Refseq : NM_002191
Protein Refseq : NP_002182
MIM : 147380
UniProt ID : P05111
Chromosome Location : 2q35
Pathway : Glycoprotein hormones, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Ovarian Infertility Genes, organism-specific biosystem
Function : cytokine activity; growth factor activity; hormone activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy