Recombinant Human INHA, GST-tagged
Cat.No. : | INHA-512H |
Product Overview : | Recombinant Human INHA(1 a.a. - 366 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-366 a.a. |
Description : | This gene encodes the alpha subunit of inhibins A and B protein complexes. These complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | Theoretical MW (kDa): 66 |
AA Sequence : | MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPE EEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP LLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPS GGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIP PNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | INHA inhibin, alpha [ Homo sapiens ] |
Official Symbol | INHA |
Synonyms | inhibin alpha chain; A-inhibin subunit |
Gene ID | 3623 |
mRNA Refseq | NM_002191 |
Protein Refseq | NP_002182 |
MIM | 147380 |
UniProt ID | P05111 |
Chromosome Location | 2q35 |
Pathway | Glycoprotein hormones, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Ovarian Infertility Genes, organism-specific biosystem |
Function | cytokine activity; growth factor activity; hormone activity |
◆ Recombinant Proteins | ||
INHA-1842H | Recombinant Human Inhibin, Alpha, His-tagged | +Inquiry |
INHA-301267H | Recombinant Human INHA protein, GST-tagged | +Inquiry |
INHA-3064R | Recombinant Rat INHA Protein | +Inquiry |
INHA/INHBA-32H | Recombinant Human INHA/INHBA protein, His-tagged | +Inquiry |
INHA-581P | Recombinant Pig INHA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHA-5204HCL | Recombinant Human INHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INHA Products
Required fields are marked with *
My Review for All INHA Products
Required fields are marked with *