"ACVR1" Related Products

Recombinant Human Activin A Receptor, Type I, Fc Chimera

Cat. No.: ACVR1-489H
Product Overview: Recombinant human activin A receptor, Type I encoding the signal peptide and extracellular domain of human activin A receptor, Type I (aa 1-123) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: Activin A receptor, type I, Fc Chimera (also known as ACVR1 or ALK-2) is an activin type I receptor. The activin type I receptors transducer signals for a variety of members of the transforming growth factor (TGF) beta superfamily of ligands. This family of cytokine and hormones include activin, anti-mϋlle rian hormone (AMH), bone morphogenetic proteins (BMPs) and nodal. Despite the large amount of processes that these ligands regulate, they all operate through essentially the same pathway: A ligand binds to a type II receptor, which recruits and trans-phosphorylates a type I receptor.
Source: Human 293 cells.
Amino Acid Sequence: MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass: Under reducing conditions Activin A Receptor, Type I, Fc Chimera migrates as a broad band between 40 and 48 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation.
PI: Activin A Receptor, Type I, Fc Chimera separates into a number of glycoforms with an observed pI between 5.5 and 8.5 on 2D PAGE due to post-translational modifications, in particular glycosylation.
% Carbohydrate: Purified Activin A Receptor, Type I, Fc Chimera consists of 3-20% carbohydrate by weight.
Glycosylation: Activin A Receptor, Type I, Fc Chimera contains N-linked oligosaccharides and may contain O-linked oligosaccharides.
Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Gene Name: VR1 activin A receptor, type I [ Homo sapiens ]
Synonyms: ACVR1; activin A receptor, type I; FOP; ALK2; SKR1; TSRI; ACTRI; ACVR1A; ACVRLK2; OTTHUMP00000204604; OTT HUMP000002 04626; hydroxyalkyl-protein kinase; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; EC 2.7.11.30
Gene ID: 90
mRNA Refseq: NM_001105
Protein Refseq: NP_001096
UniProt ID: Q04771
Chromosome Location: 2q23-q24
MIM: 102576
Pathway: Cytokine-cytokine receptor interaction; TGF-beta signaling pathway
Function: ATP binding; SMAD binding; activin binding; activin receptor activity, type I; follistatin binding; gnesium ion binding; manganese ion binding; nucleotide binding; protein homodimerization activity; receptor activity; transferase activity; transforming growth factor beta binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.