Recombinant Human Activin A Receptor, Type I, Fc Chimera

• Cat.No.: ACVR1-489H
• Product Overview: Recombinant human activin A receptor, Type I encoding the signal peptide and extracellular domain of human activin A receptor, Type I (aa 1-123) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modifiedhuman 293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Protein Length: 1-123 a.a.
• Description: Activin A receptor, type I, Fc Chimera (also known as ACVR1 or ALK-2) is an activin type I receptor. The activin type I receptors transducer signals for a variety of members of the transforming growth factor (TGF) beta superfamily of ligands. This family of cytokine and hormones include activin, anti-mϋlle rian hormone (AMH), bone morphogenetic proteins (BMPs) and nodal. Despite the large amount of processes that these ligands regulate, they all operate through essentially the same pathway: A ligand binds to a type II receptor, which recruits and trans-phosphorylates a type I receptor.
• Amino Acid Sequence: MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
• Molecular Mass: Under reducing conditions Activin A Receptor, Type I, Fc Chimera migrates as a broad band between 40 and 48 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation.
• PI: Activin A Receptor, Type I, Fc Chimera separates into a number of glycoforms with an observed pI between 5.5 and 8.5 on 2D PAGE due to post-translational modifications, in particular glycosylation.
• % Carbohydrate: Purified Activin A Receptor, Type I, Fc Chimera consists of 3-20% carbohydrate by weight.
• Glycosylation: Activin A Receptor, Type I, Fc Chimera contains N-linked oligosaccharides and may contain O-linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

Gene Information

• Gene Name: VR1 activin A receptor, type I [ Homo sapiens ]
• Synonyms: ACVR1; activin A receptor, type I; FOP; ALK2; SKR1; TSRI; ACTRI; ACVR1A; ACVRLK2; OTTHUMP00000204604; OTT HUMP000002 04626; hydroxyalkyl-protein kinase; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; EC 2.7.11.30
• Gene ID: 90
• mRNA Refseq: NM_001105
• Protein Refseq: NP_001096
• UniProt ID: Q04771
• Chromosome Location: 2q23-q24
• MIM: 102576
• Pathway: Cytokine-cytokine receptor interaction; TGF-beta signaling pathway
• Function: ATP binding; SMAD binding; activin binding; activin receptor activity, type I; follistatin binding; gnesium ion binding; manganese ion binding; nucleotide binding; protein homodimerization activity; receptor activity; transferase activity; transforming growth factor beta binding