"DMBT1" Related Products

Recombinant Human DMBT1

Cat.No.: DMBT1-26786TH
Product Overview: Recombinant fragment of Human gp340 (aa 1377-1485) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa, inclusive of tag.
Description: Loss of sequences from human chromosome 10q has been associated with the progression of human cancers.The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line.DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized.The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID).Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition.This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.
Protein length: 109 amino acids
Molecular Weight: 37.620kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in alveolar and macrophage tissues. In some macrophages, expression is seen on the membrane, and in other macrophages, strongly expressed in the phagosome/phagolysosome compartments. Expressed in lung, trachea, salivary gland, small intes
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DYSCGGFLSQPSGDFSSPFYPGNYPNNAKCVWDIEVQNNY RVTVIFRDVQLEGGCNYDYIEVFDGPYRSSPLIARVCDGA RGSFTSSSNFMSIRFISDHSITRRGFRAE
Sequence Similarities: Belongs to the DMBT1 family.Contains 2 CUB domains.Contains 14 SRCR domains.Contains 1 ZP domain.
Gene Name: DMBT1 deleted in malignant brain tumors 1 [ Homo sapiens ]
Official Symbol: DMBT1
Synonyms: DMBT1; deleted in malignant brain tumors 1; deleted in malignant brain tumors 1 protein; GP340; muclin;
Gene ID: 1755
mRNA Refseq: NM_004406
Protein Refseq: NP_004397
MIM: 601969
Uniprot ID: Q9UGM3
Chromosome Location: 10q25.3-q26.1
Pathway: Salivary secretion, organism-specific biosystem; Salivary secretion, conserved biosystem;
Function: Gram-negative bacterial cell surface binding; Gram-positive bacterial cell surface binding; calcium-dependent protein binding; pattern recognition receptor activity; scavenger receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.