"EPHA7" Related Products

Expand
Expand

Recombinant Human EPHA7

Cat.No.: EPHA7-26442TH
Product Overview: Recombinant full length Human Eph receptor A7 with an N terminal proprietary tag; Predicted MWt 56.32 kDa.
Description: This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
Protein length: 279 amino acids
Molecular Weight: 56.320kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKA QQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPN QNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK ETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDL GERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKV YYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE EAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK
Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.Contains 2 fibronectin type-III domains.Contains 1 protein kinase domain.Contains 1 SAM (sterile alpha motif) domain.
Gene Name: EPHA7 EPH receptor A7 [ Homo sapiens ]
Official Symbol: EPHA7
Synonyms: EPHA7; EPH receptor A7; EphA7; ephrin type-A receptor 7; Hek11;
Gene ID: 2045
mRNA Refseq: NM_004440
Protein Refseq: NP_004431
MIM: 602190
Uniprot ID: Q15375
Chromosome Location: 6q16.3
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem; EphrinA-EPHA pathway, organism-specific biosystem;
Function: ATP binding; GPI-linked ephrin receptor activity; axon guidance receptor activity; chemorepellent activity; ephrin receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.