Recombinant Human EPHA7
Cat.No. : | EPHA7-26442TH |
Product Overview : | Recombinant full length Human Eph receptor A7 with an N terminal proprietary tag; Predicted MWt 56.32 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. |
Protein length : | 279 amino acids |
Molecular Weight : | 56.320kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKA QQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPN QNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK ETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDL GERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKV YYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE EAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK |
Sequence Similarities : | Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.Contains 2 fibronectin type-III domains.Contains 1 protein kinase domain.Contains 1 SAM (sterile alpha motif) domain. |
Gene Name : | EPHA7 EPH receptor A7 [ Homo sapiens ] |
Official Symbol : | EPHA7 |
Synonyms : | EPHA7; EPH receptor A7; EphA7; ephrin type-A receptor 7; Hek11; |
Gene ID : | 2045 |
mRNA Refseq : | NM_004440 |
Protein Refseq : | NP_004431 |
MIM : | 602190 |
Uniprot ID : | Q15375 |
Chromosome Location : | 6q16.3 |
Pathway : | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem; EphrinA-EPHA pathway, organism-specific biosystem; |
Function : | ATP binding; GPI-linked ephrin receptor activity; axon guidance receptor activity; chemorepellent activity; ephrin receptor binding; |
Products Types
◆ Recombinant Protein | ||
EPHA7-1899H | Recombinant Human EPHA7 Protein, MYC/DDK-tagged | +Inquiry |
EPHA7-1778R | Recombinant Rat EPHA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPHA7-226H | Recombinant Human EPHA7 Protein, His-tagged | +Inquiry |
EPHA7-3394H | Recombinant Human EPHA7 Protein, GST-tagged | +Inquiry |
Epha7-134M | Recombinant Mouse Epha7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
EPHA7-1100RCL | Recombinant Rat EPHA7 cell lysate | +Inquiry |
EPHA7-414HCL | Recombinant Human EPHA7 cell lysate | +Inquiry |
EPHA7-2236HCL | Recombinant Human EPHA7 cell lysate | +Inquiry |
◆ Assay kits | ||
Kit-1554 | U2OS EphA7 Bioassay Kit | +Inquiry |
Kit-1581 | EphA7 Functional Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket