Recombinant Full Length Human EPHA7 Protein, GST-tagged
| Cat.No. : | EPHA7-4347HF | 
| Product Overview : | Human EPHA7 full-length ORF ( AAH27940.1, 1 a.a. - 279 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 279 amino acids | 
| Description : | This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Increased expression of this gene is associated with multiple forms of carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013] | 
| Molecular Mass : | 56.32 kDa | 
| AA Sequence : | MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | EPHA7 EPH receptor A7 [ Homo sapiens ] | 
| Official Symbol | EPHA7 | 
| Synonyms | EPHA7; EPH receptor A7; EphA7; ephrin type-A receptor 7; Hek11; EK11; EHK-3; EPH-like kinase 11; EPH homology kinase 3; Eph homology kinase-3; receptor protein-tyrosine kinase HEK11; tyrosine-protein kinase receptor EHK-3; EHK3; HEK11; | 
| Gene ID | 2045 | 
| mRNA Refseq | NM_004440 | 
| Protein Refseq | NP_004431 | 
| MIM | 602190 | 
| UniProt ID | Q15375 | 
| ◆ Recombinant Proteins | ||
| EPHA7-697H | Recombinant Human EPH Receptor A7, GST-tagged | +Inquiry | 
| EPHA7-1778R | Recombinant Rat EPHA7 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| EPHA7-369H | Recombinant Human EPHA7 Protein, DDK/His-tagged | +Inquiry | 
| EPHA7-12490H | Recombinant Human EPHA7, GST-tagged | +Inquiry | 
| EPHA7-4067Z | Recombinant Zebrafish EPHA7 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| EPHA7-414HCL | Recombinant Human EPHA7 cell lysate | +Inquiry | 
| EPHA7-1100RCL | Recombinant Rat EPHA7 cell lysate | +Inquiry | 
| EPHA7-2236HCL | Recombinant Human EPHA7 cell lysate | +Inquiry | 
| EPHA7-2125MCL | Recombinant Mouse EPHA7 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPHA7 Products
Required fields are marked with *
My Review for All EPHA7 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            