"FGFR1" Related Products

Expand
Expand

Recombinant Human FGFR1

Cat.No.: FGFR1-28886TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-363 of Human FGFR1 alpha fused to the Fc region of human IgG1 expressed in modified human 293 cells.
Description: The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds both acidic and basic fibroblast growth factors and is involved in limb induction. Mutations in this gene have been associated with Pfeiffer syndrome, Jackson-Weiss syndrome, Antley-Bixler syndrome, osteoglophonic dysplasia, and autosomal dominant Kallmann syndrome 2. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: Theoretical Sequence:RPSPTLPEQAQPWGAPVEVESFLVHPGDL LQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEV QDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDD DDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLH AVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGY KVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQ LDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSD PQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKE MEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE ALEGIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPGK
Gene Name: FGFR1 fibroblast growth factor receptor 1 [ Homo sapiens ]
Official Symbol: FGFR1
Synonyms: FGFR1; fibroblast growth factor receptor 1; FLT2, fms related tyrosine kinase 2 , KAL2; BFGFR; CD331; CEK; FLG; H2; H3; H4; H5; N SAM; Pfeiffer syndrome;
Gene ID: 2260
mRNA Refseq: NM_001174063
Protein Refseq: NP_001167534
MIM: 136350
Uniprot ID: P11362
Chromosome Location: 8p12
Pathway: Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem;
Function: ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.