Recombinant Human FGFR1
Cat.No. : | FGFR1-28886TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-363 of Human FGFR1 alpha fused to the Fc region of human IgG1 expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-363 a.a. |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor receptor (FGFR) family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds both acidic and basic fibroblast growth factors and is involved in limb induction. Mutations in this gene have been associated with Pfeiffer syndrome, Jackson-Weiss syndrome, Antley-Bixler syndrome, osteoglophonic dysplasia, and autosomal dominant Kallmann syndrome 2. Chromosomal aberrations involving this gene are associated with stem cell myeloproliferative disorder and stem cell leukemia lymphoma syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:RPSPTLPEQAQPWGAPVEVESFLVHPGDL LQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEV QDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDD DDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLH AVPAAKTVKFKCPSSGTPNPTLRWLKNGKEFKPDHRIGGY KVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHTYQ LDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSD PQPHIQWLKHIEVNGSKIGPDNLPYVQILKTAGVNTTDKE MEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE ALEGIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEY KCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNH YTQKSLSLSPGK |
Gene Name | FGFR1 fibroblast growth factor receptor 1 [ Homo sapiens ] |
Official Symbol | FGFR1 |
Synonyms | FGFR1; fibroblast growth factor receptor 1; FLT2, fms related tyrosine kinase 2 , KAL2; BFGFR; CD331; CEK; FLG; H2; H3; H4; H5; N SAM; Pfeiffer syndrome; |
Gene ID | 2260 |
mRNA Refseq | NM_001174063 |
Protein Refseq | NP_001167534 |
MIM | 136350 |
Uniprot ID | P11362 |
Chromosome Location | 8p12 |
Pathway | Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; |
Function | ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; fibroblast growth factor-activated receptor activity; |
◆ Recombinant Proteins | ||
FGFR1-28H | Recombinant Active Human FGFR1 (W666R) Mutant Protein, GST-tagged | +Inquiry |
FGFR1-138HF | Recombinant Human FGFR1 Protein, Fc/His-tagged, FITC conjugated | +Inquiry |
FGFR1-207H | Recombinant Human FGFR1 protein, His-tagged | +Inquiry |
FGFR1-210H | Recombinant Human FGFR1 protein, DDK/His-tagged | +Inquiry |
FGFR1-4121H | Active Recombinant Human FGFR1 Protein, GST/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGFR1-2133MCL | Recombinant Mouse FGFR1 cell lysate | +Inquiry |
FGFR1-476HCL | Recombinant Human FGFR1 cell lysate | +Inquiry |
FGFR1-1171CCL | Recombinant Cynomolgus FGFR1 cell lysate | +Inquiry |
FGFR1-2765HCL | Recombinant Human FGFR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGFR1 Products
Required fields are marked with *
My Review for All FGFR1 Products
Required fields are marked with *
0
Inquiry Basket