"FPR2" Related Products

Recombinant Human FPR2

Cat.No.: FPR2-28948TH
Product Overview: Recombinant fragment corresponding to amino acids 163-205 of Human FPRL1 with an N terminal proprietary tag; Predicted MWt 30.36 kDa.
Description: N-formyl peptide receptor 2 is a protein that in humans is encoded by the FPR2 gene.
Protein length: 43 amino acids
Molecular Weight: 30.360kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.
Gene Name: FPR2 formyl peptide receptor 2 [ Homo sapiens ]
Official Symbol: FPR2
Synonyms: FPR2; formyl peptide receptor 2; formyl peptide receptor like 1 , FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R;
Gene ID: 2358
mRNA Refseq: NM_001005738
Protein Refseq: NP_001005738
MIM: 136538
Uniprot ID: P25090
Chromosome Location: 19q13.3-q13.4
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Formyl peptide receptors bind formyl peptides and many other ligands, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function: G-protein coupled receptor activity; N-formyl peptide receptor activity; receptor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.