"MECP2" Related Products

Expand
Expand
Expand

Recombinant Human MECP2

Cat.No.: MECP2-27384TH
Product Overview: Recombinant fragment corresponding to amino acids 81-170 of Human MeCP2 with a proprietary tag; Predicted MWt 35.53 kDa including tag.
Description: DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females.
Protein length: 90 amino acids
Molecular Weight: 35.530kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Present in all adult somatic tissues tested.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ
Sequence Similarities: Contains 2 A.T hook DNA-binding domains.Contains 1 MBD (methyl-CpG-binding) domain.
Gene Name: MECP2 methyl CpG binding protein 2 (Rett syndrome) [ Homo sapiens ]
Official Symbol: MECP2
Synonyms: MECP2; methyl CpG binding protein 2 (Rett syndrome); mental retardation, X linked 16 , mental retardation, X linked 79 , MRX16, MRX79, RTT; methyl-CpG-binding protein 2;
Gene ID: 4204
mRNA Refseq: NM_001110792
Protein Refseq: NP_001104262
MIM: 300005
Uniprot ID: P51608
Chromosome Location: Xq28
Function: DNA binding; double-stranded methylated DNA binding; protein N-terminus binding; protein binding; protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.