Recombinant Human NCAM1
Cat.No. : | NCAM1-30370TH |
Product Overview : | Recombinant fragment corresponding to amino acids 611-710 of Human NCAM with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein has been shown to be involved in development of the nervous system, and for cells involved in the expansion of T cells and dendritic cells which play an important role in immune surveillance. Alternative splicing results in multiple transcript variants. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP |
Sequence Similarities : | Contains 2 fibronectin type-III domains.Contains 5 Ig-like C2-type (immunoglobulin-like) domains. |
Gene Name | NCAM1 neural cell adhesion molecule 1 [ Homo sapiens ] |
Official Symbol | NCAM1 |
Synonyms | NCAM1; neural cell adhesion molecule 1; CD56; NCAM; |
Gene ID | 4684 |
mRNA Refseq | NM_000615 |
Protein Refseq | NP_000606 |
MIM | 116930 |
Uniprot ID | P13591 |
Chromosome Location | 11q23-q24 |
Pathway | Axon guidance, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
◆ Recombinant Proteins | ||
NCAM1-4266H | Recombinant Human Neural Cell Adhesion Molecule 1 | +Inquiry |
Ncam1-5926M | Recombinant Mouse Ncam1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCAM1-0547H | Recombinant Human NCAM1 protein, His-tagged, FITC-Labeled | +Inquiry |
Ncam1-685M | Active Recombinant Mouse Ncam1, His-tagged | +Inquiry |
NCAM1-248H | Recombinant Human NCAM1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCAM1-858RCL | Recombinant Rat NCAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCAM1 Products
Required fields are marked with *
My Review for All NCAM1 Products
Required fields are marked with *