"NCAM1" Related Products

Expand
Expand
Expand

Recombinant Human NCAM1

Cat.No.: NCAM1-30370TH
Product Overview: Recombinant fragment corresponding to amino acids 611-710 of Human NCAM with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
Description: This gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein has been shown to be involved in development of the nervous system, and for cells involved in the expansion of T cells and dendritic cells which play an important role in immune surveillance. Alternative splicing results in multiple transcript variants.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
Sequence Similarities: Contains 2 fibronectin type-III domains.Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name: NCAM1 neural cell adhesion molecule 1 [ Homo sapiens ]
Official Symbol: NCAM1
Synonyms: NCAM1; neural cell adhesion molecule 1; CD56; NCAM;
Gene ID: 4684
mRNA Refseq: NM_000615
Protein Refseq: NP_000606
MIM: 116930
Uniprot ID: P13591
Chromosome Location: 11q23-q24
Pathway: Axon guidance, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Developmental Biology, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.