"NONO" Related Products

Expand
Expand
Expand

Recombinant Human NONO, His-tagged

Cat.No.: NONO-28748TH
Product Overview: Recombinant fragment, corresponding to amino acids 185-471 of Human nmt55 / p54nrb with N terminal His tag; MWt 36kDa.
Description: This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
Conjugation: HIS
Source: E. coli
Tissue specificity: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Also found in a number of breast tumor cell lines.
Form: Lyophilised:Reconstitute with 113 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTV EPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGS FEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEM EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRK QLELRQEEERRRREEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGP ATMMPDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAF NRAAPGAEFAPNKRRRY
Sequence Similarities: Contains 2 RRM (RNA recognition motif) domains.
Gene Name: NONO non-POU domain containing, octamer-binding [ Homo sapiens ]
Official Symbol: NONO
Synonyms: NONO; non-POU domain containing, octamer-binding; non POU domain containing, octamer binding; non-POU domain-containing octamer-binding protein; NMT55; non Pou domain containing octamer (ATGCAAAT) binding protein; NRB54; Nuclear RNA binding protein; 54 kD
Gene ID: 4841
mRNA Refseq: NM_001145408
Protein Refseq: NP_001138880
MIM: 300084
Uniprot ID: Q15233
Chromosome Location: Xq13.1
Pathway: Circadian rhythm pathway, organism-specific biosystem; mRNA processing, organism-specific biosystem;
Function: DNA binding; RNA binding; identical protein binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.