"SULT1C2" Related Products

Recombinant Human SULT1C2, His-tagged

Cat.No.: SULT1C2-30914TH
Product Overview: Recombinant full length Human SULT1C2 (amino acids 1-296) with an N terminal His tag; 316aa, 37kDa inclusive of tag.
Description: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Protein length: 296 amino acids
Conjugation: HIS
Molecular Weight: 37.000kDa inclusive of tags
Source: E. coli
Tissue specificity: Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
Sequence Similarities: Belongs to the sulfotransferase 1 family.
Gene Name: SULT1C2 sulfotransferase family, cytosolic, 1C, member 2 [ Homo sapiens ]
Official Symbol: SULT1C2
Synonyms: SULT1C2; sulfotransferase family, cytosolic, 1C, member 2; sulfotransferase family, cytosolic, 1C, member 1 , SULT1C1; sulfotransferase 1C2; ST1C1;
Gene ID: 6819
mRNA Refseq: NM_001056
Protein Refseq: NP_001047
MIM: 602385
Uniprot ID: O00338
Chromosome Location: 2q12.3
Pathway: Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem;
Function: sulfotransferase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.