"TPM3" Related Products

Expand
Expand
Expand

Recombinant Human TPM3, His-tagged

Cat.No.: TPM3-30392TH
Product Overview: Recombinant full length Human Tropomyosin 3 with N terminal His tag; 272 amino acids with tag, Predicted MWt 31.6 kDa.
Description: This gene encodes a member of the tropomyosin family of actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosins are dimers of coiled-coil proteins that polymerize end-to-end along the major groove in most actin filaments. They provide stability to the filaments and regulate access of other actin-binding proteins. In muscle cells, they regulate muscle contraction by controlling the binding of myosin heads to the actin filament. Mutations in this gene result in autosomal dominant nemaline myopathy, and oncogenes formed by chromosomal translocations involving this locus are associated with cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length: 248 amino acids
Conjugation: HIS
Molecular Weight: 31.600kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMAGITTIEAVKRKIQV LQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRI QLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIEN RALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVII EGDLERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEE KYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKT IDDLEDKLKCTKEEHLCTQRMLDQTLLDLNEM
Sequence Similarities: Belongs to the tropomyosin family.
Gene Name: TPM3 tropomyosin 3 [ Homo sapiens ]
Official Symbol: TPM3
Synonyms: TPM3; tropomyosin 3; NEM1; tropomyosin alpha-3 chain; TRK;
Gene ID: 7170
mRNA Refseq: NM_001043351
Protein Refseq: NP_001036816
MIM: 191030
Uniprot ID: P06753
Chromosome Location: 1q21.2
Pathway: Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem;
Function: actin binding; molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.