"PTPN1" Related Products

Expand
Expand

Recombinant Human PTPN1

Cat. No.: PTPN1-537H
Product Overview: Recombinant Human protein tyrosine phosphatase, non-receptor type 1 was expressed inE.coliand it was purified by conventional column chromatographic techniques. MW = 37.3 kDa (321 aa).
Description: The protein coding region of the catalytic domain of PTP-1B (amino acids 1-321) was cloned into an E. coli expression vector. The protein encoded by this gene is the founding member of the protein tyrosine phosphatase (PTP) family, which was isolated and identified based on its enzymatic activity and amino acid sequence. PTPs catalyze the hydrolysis of the phosphate monoesters specifically on tyrosine residues.
Source: Escherichia Coli.
Form: Liquid. In 25 mM Tris-HCl buffer (pH 7.5) containing 1 mM DTT 2 mM β-mercaptoethanol, 1 mM EDTA, 20%Glycerol.
Purity: > 95% by SDS - PAGE.
Concentration: 1 mg/ml (determined by Bradford assay).
Sequences Of Amino Acids: MEMEKEFEQI DKSGSWAAIY QDIRHEASDF PCRVAKLPKN KNRNRYRDVS PF D HSRIKLH QEDNDYINAS LIKMEEAQRS YILTQGPLPNTCGHFWEMVW EQKS R G V VML NRVMEKGSLK CAQYWPQKEE KEMIFEDTNL KLTLISEDIK SYYT VRQLEL ENLTTQETREILHFHYTTWPDFGVPESPAS FLNFLFKVRE SGS LSPE HGPV VV H CSAGIG RSGTFCLADT CLLLMDKRKD PSSVDIKKVLLEMRKFRMGLIQTADQL RFS YLAVIEGAKF IMGDSSVQDQ WKELSHEDLE PPPEHIPPPP RPP KR IL E PH N .
Specific Acitivity: 10,000units/mg of PTP1B.
Unit Definition: One unit will hydrolyze 1nanomole of p-nitrophenyl phosphatate per minute at pH 7.4 at 37°C using 10mM of substrate.
Storage: Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: PTPN1 protein tyrosine phosphatase, non-receptor type 1 [ Homo sapiens ]
Synonyms: PTPN1; protein tyrosine phosphatase, non-receptor type 1; Tyrosine-protein phosphatase non-receptor type 1; EC 3.1.3.48; Protein-tyrosine phosphatase 1B; PTP-1B; PTP1B; OTTHUMP00000031266; protein tyrosine phosphatase 1B; Protein-tyrosine phosphatase 1B; protein tyrosine phosphatase, placental
Gene ID: 5770
mRNA Refseq: NM_002827
Protein Refseq: NP_002818
MIM: 176885
UniProt ID: P18031
Chromosome Location: 20q13.1-q13.2
Pathway: Adherens junction; Insulin signaling pathway; Hemostasis; Integrin cell surface interactions
Function: hydrolase activity; insulin receptor binding; protein binding; protein tyrosine phosphatase activity; zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.