"IL7" Related Products

Expand
Expand

GMP Recombinant Human IL7 Protein

Cat.No.: IL7-151HG
Product Overview: Recombinant Human IL7 (Asp26-His177) with a 6His tag at the C-terminus was produced in HEK293 cell in an animal component free process under cGMP guidelines.
Description: Human Interleukin 7 (IL-7) is a potent lymphoid cell growth factor stimulating the proliferation of lymphoid progenitors. IL7 can associate with the hepatocyte growth factor (HGF) to form a hybrid cytokine that functions as a pre-pro-B cell growth-stimulating factor. Human IL7 cDNA encodes a 177 amino acid precursor protein containing a 25 amino acid signal peptide and a 152 amino acid mature protein. Human and mouse IL7 share 65% sequence identity in the mature region and both exhibit cross-species activity. IL-7 signals via IL-7 receptor (IL7R) activating multiple pathways including JaK/STAT and PI3K/AKT, which regulate lymphocyte survival, glucose uptake, proliferation, and differentiation. IL-7 is also associated with cytoplasmic IL2-R gamma for signal transduction.
Source: HEK293 cell
Species: Human
Tag : His
Form: Lyophilized.
Bio-activity: 2x10^6U/mg
AA Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQ FLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCF LKRLLQEIKTCWNKILMGTKEHVDHHHHHH
Residual Host Cell DNA Content: <10pg/mg
Residual Host Cell Protein Content: <1ug/mg
Endotoxin: <0.1EU/ug
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Usage: Recommemnd working concentration: 40ng/ml
Storage: Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration >100μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name: IL7 interleukin 7 [ Homo sapiens ]
Official Symbol: IL7
Synonyms: IL7; interleukin 7; interleukin-7; IL 7; IL-7
Gene ID: 3574
mRNA Refseq: NM_000880
Protein Refseq: NP_000871
MIM: 146660
UniProt ID: P13232

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.