Native E. coli L-asparagine amidohydrolase therapeutic protein (Asparaginase Escherichia coli)
Cat.No. : | L-asparagine amidohydrolase-P009E |
Product Overview : | L-asparagine amidohydrolase from E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Tag : | Non |
ProteinLength : | 303aa |
Description : | L-asparagine amidohydrolase played an important role in many functions. |
Molecular Mass : | 31.7 Kda |
AA Sequence : | QMSLQQELRYIEALSAIVETGQKMLEAGESALDVVTEAVRLLEECPLFNAGIGAVFTRDETHELDACVMDG NTLKAGAVAGVSHLRNPVLAARLVMEQSPHVMMIGEGAENFAFARGMERVSPEIFSTSLRYEQLLAARKEG ATVLDHSGAPLDEKQKMGTVGAVALDLDGNLAAATSTGGMTNKLPGRVGDSPLVGAGCYANNASVAVSCTG TGEVFIRALAAYDIAALMDYGGLSLAEACERVVMEKLPTLGGSGGLIAIDHEGNVALPFNTEGMYRAWGYA GDTPTTGIYREKGDTVATQ |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | L-asparagine amidohydrolase; Asparaginase Escherichia coli |
◆ Recombinant Proteins | ||
RFL35823BF | Recombinant Full Length Buchnera Aphidicola Subsp. Acyrthosiphon Pisum Flagellar Biosynthetic Protein Flip(Flip) Protein, His-Tagged | +Inquiry |
OLFR478-11727M | Recombinant Mouse OLFR478 Protein | +Inquiry |
LIMD1-645H | Recombinant Human LIMD1 Protein, MYC/DDK-tagged | +Inquiry |
ARL13B-9543Z | Recombinant Zebrafish ARL13B | +Inquiry |
MED13L-3450H | Recombinant Human MED13L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CGA-8356H | Native Human CGA | +Inquiry |
LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
MMP9-29698TH | Native Human MMP9 | +Inquiry |
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
C. jejuni-24 | Native Campylobacter jejuni Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMCO1-1027HCL | Recombinant Human TMCO1 293 Cell Lysate | +Inquiry |
HNRNPD-5448HCL | Recombinant Human HNRNPD 293 Cell Lysate | +Inquiry |
HSPA2-5355HCL | Recombinant Human HSPA2 293 Cell Lysate | +Inquiry |
PPIE-2971HCL | Recombinant Human PPIE 293 Cell Lysate | +Inquiry |
YAF2-1943HCL | Recombinant Human YAF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All L-asparagine amidohydrolase Products
Required fields are marked with *
My Review for All L-asparagine amidohydrolase Products
Required fields are marked with *
0
Inquiry Basket