Recombinant Active Human EPCAM Protein, His-tagged(C-ter)

• Cat.No.: EPCAM-66H
• Product Overview: Recombinant Active Human EPCAM Protein with His tag (C-ter) was expressed in E. coli.

Specification

• Description: This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008]
• Source: E. coli
• Species: Human
• Tag: His(C-ter)
• Form: Powder
• Bio-activity: Determined by the ability of the immobilized protein to support the adhesion of the 3T3 cells. The ED50 for this effect is 0.2-1.7 ng/mL.
• AA Sequence: MQEECVCENYKLAVNCFVNNNRQCQ CTSVGAQNTVICSKLAAKCLVMKAE MNGSKLGRRAKPEGALQNNDGLYDP DCDESGLFKAKQCNGTSMCWCVNTA GVRGSKLGRRAKPEGALQNNDGLYD PDCDESGLFKAKQCNGTSMCWCVNT A GVRSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHS KKMDLTVNGEQLDLDPGQTLIYYVD EKAPEFSMQGLK
• Endotoxin: Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
• Purity: > 95% (by SDS-PAGE)
• Applications: SDS-PAGE
• Notes: For laboratory research only, not for drug, diagnostic or other use.
• Storage: Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
• Storage Buffer: PBS (pH 8.0)
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.

Gene Information

• Gene Name: EPCAM epithelial cell adhesion molecule [ Homo sapiens ]
• Official Symbol: EPCAM
• Synonyms: EPCAM; epithelial cell adhesion molecule; antigen identified by monoclonal AUA1 , M4S1, MIC18, TACSTD1, tumor associated calcium signal transducer 1; 17 1A; 323/A3; CD326; CO 17A; EGP 2; EGP34; EGP40; Ep CAM; ESA; GA733 2; HEA125; KS1/4; KSA; Ly74; MH99; MK 1; MOC31; TACST 1; TROP1; epithelial glycoprotein 314; human epithelial glycoprotein-2; cell surface glycoprotein Trop-1; adenocarcinoma-associated antigen; tumor-associated calcium signal transducer 1; major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); M4S1; MK-1; DIAR5; EGP-2; MIC18; EGP314; HNPCC8; TACSTD1; GA733-2
• Gene ID: 4072
• mRNA Refseq: NM_002354
• Protein Refseq: NP_002345
• MIM: 185535
• UniProt ID: P16422