Recombinant Danio rerio fshb & cga, Strep-tagged
Cat.No. : | fshb-20D |
Product Overview : | Recombinant protein is encoded by a fusion of the mature follitropin subunit beta (residues 17 - 130) and glycoprotein hormones alphachain (residues 24 - 117) linked by a (gggs)4 peptide. It contains a N-terminal Strep-tag. The protein was over-expressed in HEK293EBNA1 cells and purified to homogeneity. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zebrafish |
Source : | HEK293 |
Tag : | Strep II |
Protein Length : | 17-130 a.a. |
Description : | The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. All of these glycoproteins consist of an identical alpha subunit and a hormone-specific beta subunit that confers biological specificity. |
Form : | PBS without preservative. |
Molecular Mass : | The calculated molecular weight of recombinant Danio rerio FSH is 27.9 kDa. |
AA Sequence : | gswshpqfekgswshpqfekgswshpqfekgsaesecrcscrltnisitveseecgscvtidttacaglcwtmdr vypssmaqhtqkvcnfknlmyksyefkgcpagvdsvfvypvalscecnqvnsdttdwgaispqttscsihgggsg ggsgggsgggysrndvsnygceecklkmnerfskpgapvyqcvgccfsrayptplrskktmlvpknitseatccv akeskmvatniplynhtdchcstcyyhks |
Storage : | - 80 °C (stable for at least 1 year). After thawing it should be stored in appropriate small aliquots at - 20 °C or - 80 °C (stable for at least 2 months). |
◆ Recombinant Proteins | ||
FSHB-342H | Recombinant Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
fshb-20D | Recombinant Danio rerio fshb & cga, Strep-tagged | +Inquiry |
Fshb-1526M | Recombinant Mouse Fshb Protein, His&GST-tagged | +Inquiry |
FSHB-529H | Recombinant Human FSHB Protein (Met1-Glu129), HIgG1 Fc-tagged | +Inquiry |
FSHB-438H | Recombinant Human FSHB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FSHB-672H | Native Human Follicle Stimulating Hormone, Beta Polypeptide | +Inquiry |
FSHB-P051H | Native Human Follicle Stimulating Hormone therapeutic protein(Urofollitropin) | +Inquiry |
FSHB-81H | Active Native Human FSH | +Inquiry |
◆ Cell & Tissue Lysates | ||
FSHB-6131HCL | Recombinant Human FSHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All fshb Products
Required fields are marked with *
My Review for All fshb Products
Required fields are marked with *
0
Inquiry Basket