Recombinant E. coli SSB

Cat.No. : Ssb-86E
Product Overview : Recombinant E. coli Single-Stranded DNA-Binding Protein/SSB is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Phe178) of E. coli SSB.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : Non
Description : Single-Stranded DNA-Binding Protein (SSB) is an essential protein that is present in all organisms ranging from viruses to humans, except Thermoproteales. It is a homotetramer, with each monomer containing one SSB domain. SSB is involved in DNA replication, recombination, and repair. This protein is essential for the replication of the chromosomes and its single-stranded DNA phages. SSB binds to single-stranded regions of DNA to prevent premature annealing, to protect the single-stranded DNA from being digested by nucleases, and to remove secondary structure from the DNA to allow other enzymes to function effectively upon it.
Form : Lyophilized from a 0.2 μM filtered solution of PBS, pH 7.4
AA Sequence : MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLA EVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGG QPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ssb Products

Required fields are marked with *

My Review for All Ssb Products

Required fields are marked with *

0
cart-icon