| Species : |
E.coli |
| Source : |
E.coli |
| Tag : |
Non |
| Description : |
Single-Stranded DNA-Binding Protein (SSB) is an essential protein that is present in all organisms ranging from viruses to humans, except Thermoproteales. It is a homotetramer, with each monomer containing one SSB domain. SSB is involved in DNA replication, recombination, and repair. This protein is essential for the replication of the chromosomes and its single-stranded DNA phages. SSB binds to single-stranded regions of DNA to prevent premature annealing, to protect the single-stranded DNA from being digested by nucleases, and to remove secondary structure from the DNA to allow other enzymes to function effectively upon it. |
| Form : |
Lyophilized from a 0.2 μM filtered solution of PBS, pH 7.4 |
| AA Sequence : |
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLA EVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGG QPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF |
| Endotoxin : |
Less than 0.1 ng/µg (1 IEU/µg). |
| Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |