Recombinant Full Length Human CRHBP Protein, C-Flag-tagged
Cat.No. : | CRHBP-866HFL |
Product Overview : | Recombinant Full Length Human CRHBP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36 kDa |
AA Sequence : | MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQF TFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDF CESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSII YPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNT VVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CRHBP corticotropin releasing hormone binding protein [ Homo sapiens (human) ] |
Official Symbol | CRHBP |
Synonyms | CRFBP; CRF-BP |
Gene ID | 1393 |
mRNA Refseq | NM_001882.4 |
Protein Refseq | NP_001873.2 |
MIM | 122559 |
UniProt ID | P24387 |
◆ Recombinant Proteins | ||
CRHBP-5061H | Recombinant Human CRHBP, His-tagged | +Inquiry |
CRHBP-852R | Recombinant Rhesus Macaque CRHBP Protein, His (Fc)-Avi-tagged | +Inquiry |
CRHBP-1808H | Recombinant Human CRHBP Protein (Tyr25-Leu322), N-His tagged | +Inquiry |
CRHBP-2297HF | Recombinant Full Length Human CRHBP Protein, GST-tagged | +Inquiry |
CRHBP-660H | Recombinant Human CRHBP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRHBP-7280HCL | Recombinant Human CRHBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRHBP Products
Required fields are marked with *
My Review for All CRHBP Products
Required fields are marked with *
0
Inquiry Basket