Recombinant Full Length Human DMC1 Protein, C-Flag-tagged
Cat.No. : | DMC1-1309HFL |
Product Overview : | Recombinant Full Length Human DMC1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the superfamily of recombinases (also called DNA strand-exchange proteins). Recombinases are important for repairing double-strand DNA breaks during mitosis and meiosis. This protein, which is evolutionarily conserved, is reported to be essential for meiotic homologous recombination and may thus play an important role in generating diversity of genetic information. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.5 kDa |
AA Sequence : | MKEDQVVAEEPGFQDEEESLFQDIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKV DKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLC VTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKF HEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTF QADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | DMC1 DNA meiotic recombinase 1 [ Homo sapiens (human) ] |
Official Symbol | DMC1 |
Synonyms | DMC1H; LIM15; dJ199H16.1 |
Gene ID | 11144 |
mRNA Refseq | NM_007068.4 |
Protein Refseq | NP_008999.2 |
MIM | 602721 |
UniProt ID | Q14565 |
◆ Recombinant Proteins | ||
Dmc1-2583M | Recombinant Mouse Dmc1 Protein, Myc/DDK-tagged | +Inquiry |
DMC1-4107H | Recombinant Human DMC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DMC1-2703H | Recombinant Human DMC1 Protein, GST-tagged | +Inquiry |
DMC1-2919Z | Recombinant Zebrafish DMC1 | +Inquiry |
DMC1-769H | Recombinant Human DMC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMC1-6900HCL | Recombinant Human DMC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DMC1 Products
Required fields are marked with *
My Review for All DMC1 Products
Required fields are marked with *
0
Inquiry Basket