Recombinant Full Length Human LDHC Protein, GST-tagged
Cat.No. : | LDHC-6969HF |
Product Overview : | Recombinant Human full-length LDHC(1 a.a. - 332 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 332 amino acids |
Description : | Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. |
Molecular Mass : | 62.7 kDa |
AA Sequence : | MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTS KITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKI SGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKE HWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGV SDVVKINLNSEEEALFKKSAETLWNIQKDLIF |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LDHC lactate dehydrogenase C [ Homo sapiens (human) ] |
Official Symbol | LDHC |
Synonyms | LDHC; lactate dehydrogenase C; CT32; LDH3; LDHX; L-lactate dehydrogenase C chain; LDH testis subunit; LDH-C; LDH-X; cancer/testis antigen 32; lactate dehydrogenase C4; lactate dehydrogenase c variant 1; lactate dehydrogenase c variant 3; lactate dehydrogenase c variant 4; NP_002292.1; EC 1.1.1.27; NP_059144.1 |
Gene ID | 3948 |
mRNA Refseq | NM_002301 |
Protein Refseq | NP_002292 |
MIM | 150150 |
UniProt ID | P07864 |
◆ Recombinant Proteins | ||
LDHC-259H | Recombinant Human LDHC, GST-tagged | +Inquiry |
Ldhc-1307M | Recombinant Mouse Ldhc Protein, MYC/DDK-tagged | +Inquiry |
Ldhc-1139R | Recombinant Rat Ldhc protein, His & T7-tagged | +Inquiry |
LDHC-001H | Recombinant Human LDHC Protein, Myc/DDK-tagged | +Inquiry |
LDHC-295H | Recombinant Human LDHC Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
LDH3-222H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHC-4787HCL | Recombinant Human LDHC 293 Cell Lysate | +Inquiry |
LDHC-4786HCL | Recombinant Human LDHC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDHC Products
Required fields are marked with *
My Review for All LDHC Products
Required fields are marked with *