Recombinant Full Length Human LIPC Protein, C-Flag-tagged
Cat.No. : | LIPC-258HFL |
Product Overview : | Recombinant Full Length Human LIPC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | LIPC encodes hepatic triglyceride lipase, which is expressed in liver. LIPC has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 53.5 kDa |
AA Sequence : | MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKTRFLLFGETNQGCQIRINHPD TLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLVDWITLAHDHYTIAVRNTRLV GKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSSIGGTHKIGRITGLDAAGPLFEGSAPSNRLS PDDASFVDAIHTFTREHMGLSVGIKQPIGHYDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHE RSVHLFIDSLLHAGTQSMAYPCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFK VYHYQLKIQFINQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKW ENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQRMTFCSENTDDLLLRPTQEKIFVKCEIK SKTSKRKIRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Glycerolipid metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | LIPC lipase C, hepatic type [ Homo sapiens (human) ] |
Official Symbol | LIPC |
Synonyms | HL; HTGL; LIPH; HDLCQ12 |
Gene ID | 3990 |
mRNA Refseq | NM_000236.3 |
Protein Refseq | NP_000227.2 |
MIM | 151670 |
UniProt ID | P11150 |
◆ Recombinant Proteins | ||
LIPC-7645P | Recombinant Pig LIPC protein, His & GST-tagged | +Inquiry |
LIPC-3293M | Recombinant Mouse LIPC protein, His-tagged | +Inquiry |
Lipc-7646R | Recombinant Rat Lipc protein, His & GST-tagged | +Inquiry |
LIPC-3724H | Recombinant Human LIPC Protein (Glu347-Pro478), His tagged | +Inquiry |
LIPC-267H | Recombinant Human LIPC, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPC-4726HCL | Recombinant Human LIPC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIPC Products
Required fields are marked with *
My Review for All LIPC Products
Required fields are marked with *
0
Inquiry Basket