Recombinant Full Length Human PEX5 Protein, C-Flag-tagged
Cat.No. : | PEX5-1651HFL |
Product Overview : | Recombinant Full Length Human PEX5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The product of this gene binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups. Although the clinical features of PBD patients vary, cells from all PBD patients exhibit a defect in the import of one or more classes of peroxisomal matrix proteins into the organelle. Defects in this gene are a cause of neonatal adrenoleukodystrophy (NALD), a cause of Zellweger syndrome (ZWS) as well as may be a cause of infantile Refsum disease (IRD). Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.7 kDa |
AA Sequence : | MAMRELVEAECGGANPLMKLAGHFTQDKALRQEGLRPGPWPPGAPASEAASKPLGVASEDELVAEFLQDQ NAPLVSRAPQTFKMDDLLAEMQQIEQSNFRQAPQRAPGVADLALSENWAQEFLAAGDAVDVTQDYNETDW SQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKL ANSEFLKFVRQIGEGQVSLESGAGSGRAQAEQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSA IELQAELEEMAKRDAEAHPWLSDYDDLTSATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLF EAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACETLRD WLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLF NLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCIN LGAHREAVEHFLEALNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLP QSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | PEX5 peroxisomal biogenesis factor 5 [ Homo sapiens (human) ] |
Official Symbol | PEX5 |
Synonyms | PXR1; PBD2A; PBD2B; PTS1R; RCDP5; PTS1-BP |
Gene ID | 5830 |
mRNA Refseq | NM_000319.5 |
Protein Refseq | NP_000310.2 |
MIM | 600414 |
UniProt ID | P50542 |
◆ Recombinant Proteins | ||
PEX5-1651HFL | Recombinant Full Length Human PEX5 Protein, C-Flag-tagged | +Inquiry |
PEX5-4045R | Recombinant Rat PEX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEX5-6650M | Recombinant Mouse PEX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEX5-1649H | Recombinant Human PEX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pex5-4532M | Recombinant Mouse Pex5 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX5-3285HCL | Recombinant Human PEX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PEX5 Products
Required fields are marked with *
My Review for All PEX5 Products
Required fields are marked with *
0
Inquiry Basket