Recombinant Full Length Human PIN1 Protein, C-Flag-tagged
Cat.No. : | PIN1-1058HFL |
Product Overview : | Recombinant Full Length Human PIN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 18.1 kDa |
AA Sequence : | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRP SSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFA LRTGEMSGPVFTDSGIHIILRTETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | RIG-I-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | PIN1 peptidylprolyl cis/trans isomerase, NIMA-interacting 1 [ Homo sapiens (human) ] |
Official Symbol | PIN1 |
Synonyms | DOD; UBL5 |
Gene ID | 5300 |
mRNA Refseq | NM_006221.4 |
Protein Refseq | NP_006212.1 |
MIM | 601052 |
UniProt ID | Q13526 |
◆ Recombinant Proteins | ||
PIN1-3825H | Recombinant Human PIN1, His tagged | +Inquiry |
PIN1-1058HFL | Recombinant Full Length Human PIN1 Protein, C-Flag-tagged | +Inquiry |
PIN1-11011Z | Recombinant Zebrafish PIN1 | +Inquiry |
PIN1-2901H | Recombinant Human PIN1, T7-tagged | +Inquiry |
PIN1-6747M | Recombinant Mouse PIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PIN1-3179HCL | Recombinant Human PIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PIN1 Products
Required fields are marked with *
My Review for All PIN1 Products
Required fields are marked with *
0
Inquiry Basket