Recombinant HPV-16 E6 Protein, His-tagged
Cat.No. : | E6-37H |
Product Overview : | Recombinant HPV-16 E6 Protein (1-158aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPV16 |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-158aa |
Description : | Plays a major role in the induction and maintenance of cellular transformation. Acts mainly as an oncoprotein by stimulating the destruction of many host cell key regulatory proteins. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase, and inactivates tumor suppressors TP53 and TP73 by targeting them to the 26S proteasome for degradation. In turn, DNA damage and chromosomal instabilities increase and lead to cell proliferation and cancer development. The complex E6/E6AP targets several other substrates to degradation via the proteasome including host DLG1 or NFX1, a repressor of human telomerase reverse transcriptase (hTERT). The resulting increased expression of hTERT prevents the shortening of telomere length leading to cell immortalization. Other cellular targets including BAK1, Fas-associated death domain-containing protein (FADD) and procaspase 8, are degraded by E6/E6AP causing inhibition of apoptosis. E6 also inhibits immune response by interacting with host IRF3 and TYK2. These interactions prevent IRF3 transcriptional activities and inhibit TYK2-mediated JAK-STAT activation by interferon alpha resulting in inhibition of the interferon signaling pathway. |
Tag : | N-His |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
Purity : | ≥95% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0. The volume before lyophilization is 568 μL/vial. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20/-80 centigrade. Our default final concentration of glycerol is 50%. |
Gene Name | E6 protein E6*;transforming protein E6 [ Human papillomavirus 16 ] |
Official Symbol | E6 |
Synonyms | E6; protein E6*;transforming protein E6 |
Gene ID | 1489078 |
Protein Refseq | NP_041325 |
UniProt ID | P03126 |
◆ Recombinant Proteins | ||
E6-5678H | Recombinant Human E6 protein, His&His-tagged | +Inquiry |
E6-1684H | Recombinant HPV-34 E6 Protein | +Inquiry |
E6-470V | Recombinant Human PapillomaVirus E6 Protein, His-tagged | +Inquiry |
E6-1682H | Recombinant HPV18 E6 Protein, His-tagged | +Inquiry |
E6-254P | Recombinant Human Papillomavirus E6 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All E6 Products
Required fields are marked with *
My Review for All E6 Products
Required fields are marked with *
0
Inquiry Basket