Recombinant Human E6 protein, His&His-tagged
Cat.No. : | E6-5678H |
Product Overview : | Recombinant Human E6 protein(P03126)(1-158aa), fused with N-terminal His tag and C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-158aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
◆ Recombinant Proteins | ||
E6-3830H | Recombinant HPV-18 E6 Protein (Full length), N-His tagged | +Inquiry |
E6-1686H | Recombinant HPV-53 E6 Protein | +Inquiry |
RFL15088EF | Recombinant Full Length Equine Herpesvirus 2 G-Protein Coupled Receptor E6(E6) Protein, His-Tagged | +Inquiry |
E6-01H | Recombinant HPV-11 E6 Protein, His-tagged | +Inquiry |
E6-1683H | Recombinant HPV-26 E6 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E6 Products
Required fields are marked with *
My Review for All E6 Products
Required fields are marked with *