Recombinant Human AIF1L protein, GST-tagged
Cat.No. : | AIF1L-8543H |
Product Overview : | Recombinant Human AIF1L protein(1-69 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-69 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDL |
Gene Name | AIF1L allograft inflammatory factor 1-like [ Homo sapiens ] |
Official Symbol | AIF1L |
Synonyms | AIF1L; allograft inflammatory factor 1-like; C9orf58, chromosome 9 open reading frame 58; FLJ12783; IBA2; ionized calcium binding adapter molecule 2; ionized calcium-binding adapter molecule 2; C9orf58; MGC29466; |
Gene ID | 83543 |
mRNA Refseq | NM_001185095 |
Protein Refseq | NP_001172024 |
UniProt ID | Q9BQI0 |
◆ Recombinant Proteins | ||
AIF1L-8543H | Recombinant Human AIF1L protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIF1L Products
Required fields are marked with *
My Review for All AIF1L Products
Required fields are marked with *
0
Inquiry Basket