Recombinant Human AMPD1 protein, GST-tagged
Cat.No. : | AMPD1-754H |
Product Overview : | Recombinant Human AMPD1(1 a.a. - 747 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-747 a.a. |
Description : | Adenosine monophosphate deaminase 1 catalyzes the deamination of AMP to IMP in skeletal muscle and plays an important role in the purine nucleotide cycle. Two other genes have been identified, AMPD2 and AMPD3, for the liver- and erythocyte-specific isoforms, respectively. Deficiency of the muscle-specific enzyme is apparently a common cause of exercise-induced myopathy and probably the most common cause of metabolic myopathy in the human. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 109.12 kDa |
AA Sequence : | MPLFKLPAEEKQIDDAMRNFAEKVFASEVKDEGGRQEISPFDVDEICPISHHEMQAHIFHLETLSTSTEARRKKR FQGRKTVNLSIPLSETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKY MQKSFQRFPKTPSKYLRNIDGEAWVANESFYPVFTPPVKKGEDPFRTDNLPENLGYHLKMKDGVVYVYPNEAAVS KDEPKPLPYPNLDTFLDDMNFLLALIAQGPVKTYTHRRLKFLSSKFQVHQMLNEMDELKELKNNPHRDFYNCRKV DTHIHAAACMNQKHLLRFIKKSYQIDADRVVYSTKEKNLTLKELFAKLKMHPYDLTVDSLDVHAGRQTFQRFDKF NDKYNPVGASELRDLYLKTDNYINGEYFATIIKEVGADLVEAKYQHAEPRLSIYGRSPDEWSKLSSWFVCNRIHC PNMTWMIQVPRIYDVFRSKNFLPHFGKMLENIFMPVFEATINPQADPELSVFLKHITGFDSVDDESKHSGHMFSS KSPKPQEWTLEKNPSYTYYAYYMYANIMVLNSLRKERGMNTFLFRPHCGEAGALTHLMTAFMIADDISHGLNLKK SPVLQYLFFLAQIPIAMSPLSNNSLFLEYAKNPFLDFLQKGLMISLSTDDPMQFHFTKEPLMEEYAIAAQVFKLS TCDMCEVARNSVLQCGISHEEKVKFLGDNYLEEGPAGNDIRRTNVAQIRMAYRYETWCYELNLIAEGLKSTE |
Purity : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | AMPD1 adenosine monophosphate deaminase 1 [ Homo sapiens ] |
Official Symbol | AMPD1 |
Synonyms | AMPD1; adenosine monophosphate deaminase 1; adenosine monophosphate deaminase 1 (isoform M); AMP deaminase 1; AMPD isoform M; MAD; MADA; skeletal muscle AMPD; AMPD; myoadenylate deaminase; adenosine monophosphate deaminase-1 (muscle); |
Gene ID | 270 |
mRNA Refseq | NM_000036 |
Protein Refseq | NP_000027 |
MIM | 102770 |
UniProt ID | P23109 |
Chromosome Location | 1p13 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem; Purine salvage, organism-specific biosystem; |
Function | AMP deaminase activity; hydrolase activity; metal ion binding; |
◆ Recombinant Proteins | ||
AMPD1-313R | Recombinant Rat AMPD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
AMPD1-3428H | Recombinant Human AMPD1, His-tagged | +Inquiry |
Ampd1-3429R | Recombinant Rat Ampd1, His-tagged | +Inquiry |
AMPD1-331HFL | Recombinant Full Length Human AMPD1 Protein, C-Flag-tagged | +Inquiry |
AMPD1-11138Z | Recombinant Zebrafish AMPD1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMPD1-8877HCL | Recombinant Human AMPD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMPD1 Products
Required fields are marked with *
My Review for All AMPD1 Products
Required fields are marked with *
0
Inquiry Basket