"ANP32A" Related Products

Expand
Expand

Recombinant Human ANP32A protein, GST-tagged

Cat.No. : ANP32A-617H
Product Overview : Human ANP32A full-length ORF ( AAH07200, 1 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.
Description : ANP32A (Acidic Nuclear Phosphoprotein 32 Family Member A) is a Protein Coding gene. Diseases associated with ANP32A include Spinocerebellar Ataxia 1. Among its related pathways are Apoptosis induced DNA fragmentation and DNA Damage. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is ANP32B.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 53.13 kDa
AA Sequence : MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Figure :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : ANP32A acidic (leucine-rich) nuclear phosphoprotein 32 family, member A [ Homo sapiens ]
Official Symbol : ANP32A
Synonyms : ANP32A; acidic (leucine-rich) nuclear phosphoprotein 32 family, member A; C15orf1; acidic leucine-rich nuclear phosphoprotein 32 family member A; I1PP2A; LANP; MAPM; mapmodulin; PHAPI; PP32; hepatopoietin Cn; acidic nuclear phosphoprotein pp32; leucine-rich acidic nuclear protein; putative HLA-DR-associated protein I; inhibitor-1 of protein phosphatase-2A; cerebellar leucine rich acidic nuclear protein; putative human HLA class II associated protein I; potent heat-stable protein phosphatase 2A inhibitor I1PP2A; HPPCn; PHAP1; MGC119787; MGC150373;
Gene ID : 8125
mRNA Refseq : NM_006305
Protein Refseq : NP_006296
MIM : 600832
UniProt ID : P39687

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.