Recombinant Human BGN Protein, GST-tagged
Cat.No. : | BGN-206H |
Product Overview : | Human BGN full-length ORF ( AAH02416.1, 1 a.a. - 368 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a small cellular or pericellular matrix proteoglycan that is closely related in structure to two other small proteoglycans, decorin and fibromodulin. The encoded protein and decorin are thought to be the result of a gene duplication. Decorin contains one attached glycosaminoglycan chain, while this protein probably contains two chains. For this reason, this protein is called biglycan. This protein is thought to function in connective tissue metabolism by binding to collagen fibrils and transfering growth factor-beta. It may promote neuronal survival. This gene is a candidate gene for the Happle syndrome. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 66.22 kDa |
AA Sequence : | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BGN biglycan [ Homo sapiens ] |
Official Symbol | BGN |
Synonyms | BGN; biglycan; biglycan proteoglycan; DSPG1; SLRR1A; bone/cartilage proteoglycan I; bone/cartilage proteoglycan-I; small leucine-rich protein 1A; dermatan sulphate proteoglycan I; PGI; PG-S1; |
Gene ID | 633 |
mRNA Refseq | NM_001711 |
Protein Refseq | NP_001702 |
MIM | 301870 |
UniProt ID | P21810 |
◆ Recombinant Proteins | ||
BGN-1427H | Recombinant Human BGN Protein (Glu20-Lys368), C-His tagged | +Inquiry |
BGN-314H | Recombinant Human BGN Protein, His-tagged | +Inquiry |
BGN-7544H | Recombinant Human BGN, His-tagged | +Inquiry |
Bgn-1639M | Recombinant Mouse Bgn protein, His-tagged | +Inquiry |
Bgn-01M | Active Recombinant Mouse Bgn Protein (Asp38-Lys369), C-6×His tagged | +Inquiry |
◆ Native Proteins | ||
BGN-13HFL | Active Recombinant Full Length Human BGN Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BGN-1124MCL | Recombinant Mouse BGN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BGN Products
Required fields are marked with *
My Review for All BGN Products
Required fields are marked with *
0
Inquiry Basket