Recombinant Human CAMP Protein, GST-Tagged
Cat.No. : | CAMP-0346H |
Product Overview : | Human CAMP full-length ORF (NP_004336.2, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 45.7 kDa |
AA Sequence : | MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CAMP cathelicidin antimicrobial peptide [ Homo sapiens ] |
Official Symbol | CAMP |
Synonyms | CAMP; cathelicidin antimicrobial peptide; CAP18; FALL 39; FALL39; LL37; 18 kDa cationic antimicrobial protein; CRAMP; HSD26; CAP-18; FALL-39; |
Gene ID | 820 |
mRNA Refseq | NM_004345 |
Protein Refseq | NP_004336 |
MIM | 600474 |
UniProt ID | P49913 |
◆ Recombinant Proteins | ||
Camp-360M | Recombinant Mouse Camp Protein, His-tagged | +Inquiry |
CAMP-2677M | Recombinant Mouse CAMP Protein | +Inquiry |
Camp-909M | Recombinant Mouse Camp Protein, MYC/DDK-tagged | +Inquiry |
CAMP-299HFL | Recombinant Full Length Human CAMP Protein, C-Flag-tagged | +Inquiry |
CAMP-491H | Recombinant Human CAMP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAMP-7871HCL | Recombinant Human CAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAMP Products
Required fields are marked with *
My Review for All CAMP Products
Required fields are marked with *
0
Inquiry Basket