Active Recombinant Human CXCL5 Protein (74 aa)
Cat.No. : | CXCL5-131C |
Product Overview : | Recombinant Human CXCL5 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 74 |
Description : | Epithelial cell-derived neutrophil-activating peptide 78 (ENA-78) is a member of the CXC subfamily of chemokines that has the Glu-Leu-Arg (ELR) motif preceding the CXC motif. Similar to other ELR containing CXC chemokines, ENA-78 is a potent neutrophil chemoattractant and activator. Proteolysis of ENA-78 with cathepsin G and chymotrypsin have yielded N-terminally truncated variants with increased biological activities. ENA-70 and ENA-74 represent truncated recombinant ENA-78 variants missing 8 and 4 aa residues, respectively, from the N-terminus. Recombinant ENA-70 and ENA-74 have been shown to have increased potency in neutrophil chemotaxis and myeloperoxidase and elastase release assays. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood neutrophils using a concentration range of 5.0-10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg. |
Molecular Mass : | 8.0 kDa, a single non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : | AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
Endotoxin : | Less than 1 EU/mg of rHuENA-78/CXCL5 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CXCL5 chemokine (C-X-C motif) ligand 5 [ Homo sapiens ] |
Official Symbol | CXCL5 |
Synonyms | CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78; |
Gene ID | 6374 |
mRNA Refseq | NM_002994 |
Protein Refseq | NP_002985 |
MIM | 600324 |
UniProt ID | P42830 |
◆ Recombinant Proteins | ||
CXCL5-05H | Recombinant Human CXCL5 Protein | +Inquiry |
CXCL5-3380M | Recombinant Mouse CXCL5 protein, His-tagged | +Inquiry |
CXCL5-12H | Recombinant Human CXCL5 protein | +Inquiry |
CXCL5-272H | Active Recombinant Human CXCL5 Protein (Arg45-Asn114), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Cxcl5-7841M | Recombinant Mouse Cxcl5 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL5-7167HCL | Recombinant Human CXCL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL5 Products
Required fields are marked with *
My Review for All CXCL5 Products
Required fields are marked with *
0
Inquiry Basket