Recombinant Human DAD1 Protein, GST-tagged

Cat.No. : DAD1-2324H
Product Overview : Human DAD1 full-length ORF ( AAH07403, 1 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DAD1, the defender against apoptotic cell death, was initially identified as a negative regulator of programmed cell death in the temperature sensitive tsBN7 cell line. The DAD1 protein disappeared in temperature-sensitive cells following a shift to the nonpermissive temperature, suggesting that loss of the DAD1 protein triggered apoptosis. DAD1 is believed to be a tightly associated subunit of oligosaccharyltransferase both in the intact membrane and in the purified enzyme, thus reflecting the essential nature of N-linked glycosylation in eukaryotes. [provided by RefSeq, Jul 2008]
Molecular Mass : 38.17 kDa
AA Sequence : MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DAD1 defender against cell death 1 [ Homo sapiens ]
Official Symbol DAD1
Synonyms DAD1; defender against cell death 1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; oligosaccharyltransferase 2 homolog (S. cerevisiae); OST2; DAD-1; oligosaccharyltransferase 2 homolog; oligosaccharyl transferase subunit DAD1;
Gene ID 1603
mRNA Refseq NM_001344
Protein Refseq NP_001335
MIM 600243
UniProt ID P61803

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DAD1 Products

Required fields are marked with *

My Review for All DAD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon