Recombinant Human DCTN1, His-tagged
Cat.No. : | DCTN1-27132TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 22-291 of Human DCTN1 isoform p135 with N terminal His tag. MWt ~31 kDa; |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein and binds to microtubules via a highly conserved glycine-rich cytoskeleton-associated protein (CAP-Gly) domain in its N-terminus. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause distal hereditary motor neuronopathy type VIIB (HMN7B) which is also known as distal spinal and bulbar muscular atrophy (dSBMA). |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Brain. |
Form : | Lyophilised:Reconstitution with 102 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | (Amino acid sequence (Sequence determined by 5 Sequencing))ASTGVAGASSSLGPSGSASAGELSSS EPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEG LRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQ EWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEM ADTADAIEMATLDKEMAEERAESLQQEVEALKERVDEL TTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDA LVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQ EELSQAESTIDE |
Sequence Similarities : | Belongs to the dynactin 150 kDa subunit family.Contains 1 CAP-Gly domain. |
Gene Name : | DCTN1 dynactin 1 [ Homo sapiens ] |
Official Symbol : | DCTN1 |
Synonyms : | DCTN1; dynactin 1; dynactin 1 (p150, Glued (Drosophila) homolog); dynactin subunit 1; p150 glued homolog (Drosophila); |
Gene ID : | 1639 |
mRNA Refseq : | NM_001135040 |
Protein Refseq : | NP_001128512 |
MIM : | 601143 |
Uniprot ID : | Q14203 |
Chromosome Location : | 2p13 |
Pathway : | Activation of Chaperones by IRE1alpha, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; G2/M Transition, organism-specific biosystem; |
Function : | motor activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
DCTN1-1458R | Recombinant Rat DCTN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DCTN1-1184H | Recombinant Human DCTN1 Protein, His-SUMO-tagged | +Inquiry |
DCTN1-2410H | Recombinant Human DCTN1 Protein, GST-tagged | +Inquiry |
DCTN1-3018C | Recombinant Chicken DCTN1 | +Inquiry |
DCTN1-1800R | Recombinant Rat DCTN1 Protein | +Inquiry |
◆ Lysates | ||
DCTN1-7043HCL | Recombinant Human DCTN1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket