Recombinant Human EDN1 protein, GST-tagged

Cat.No. : EDN1-34H
Product Overview : Recombinant Human EDN1(1 a.a. - 212 a.a) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-212 a.a.
Description : This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant expression of this gene may promote tumorigenesis. Alternative splicing results in multiple transcript variants.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 50.8 kDa
AA Sequence : MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVN TPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSK LGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name EDN1 endothelin 1 [ Homo sapiens ]
Official Symbol EDN1
Synonyms EDN1; endothelin 1; endothelin-1; ET1; preproendothelin-1; PPET1; HDLCQ7;
Gene ID 1906
mRNA Refseq NM_001168319
Protein Refseq NP_001161791
MIM
UniProt ID P05305
Chromosome Location 6p24.1
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; EGFR-dependent Endothelin signaling events, organism-specific biosystem; Endothelins, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem;
Function cytokine activity; endothelin A receptor binding; endothelin B receptor binding; endothelin B receptor binding; hormone activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EDN1 Products

Required fields are marked with *

My Review for All EDN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon