Recombinant Human EDN1 protein, GST-tagged
Cat.No. : | EDN1-34H |
Product Overview : | Recombinant Human EDN1(1 a.a. - 212 a.a) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-212 a.a. |
Description : | This gene encodes a preproprotein that is proteolytically processed to generate a secreted peptide that belongs to the endothelin/sarafotoxin family. This peptide is a potent vasoconstrictor and its cognate receptors are therapeutic targets in the treatment of pulmonary arterial hypertension. Aberrant ex |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 50.8 kDa |
AA Sequence : | MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVN TPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSK LGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | EDN1 endothelin 1 [ Homo sapiens ] |
Official Symbol | EDN1 |
Synonyms | EDN1; endothelin 1; endothelin-1; ET1; preproendothelin-1; PPET1; HDLCQ7; |
Gene ID | 1906 |
mRNA Refseq | NM_001168319 |
Protein Refseq | NP_001161791 |
MIM | |
UniProt ID | P05305 |
Chromosome Location | 6p24.1 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; EGFR-dependent Endothelin signaling events, organism-specific biosystem; Endothelins, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; |
Function | cytokine activity; endothelin A receptor binding; endothelin B receptor binding; endothelin B receptor binding; hormone activity; |
◆ Recombinant Proteins | ||
EDN1-656HF | Recombinant Full Length Human EDN1 Protein, GST-tagged | +Inquiry |
EDN1-35H | Recombinant Human EDN1 protein, His-tagged | +Inquiry |
EDN1-2802H | Recombinant Human EDN1 Protein, His-tagged, BSA Conjugated | +Inquiry |
EDN1-9068Z | Recombinant Zebrafish EDN1 | +Inquiry |
EDN1-2640M | Recombinant Mouse EDN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
EDN1-8305H | Native Human EDN1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDN1-6721HCL | Recombinant Human EDN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDN1 Products
Required fields are marked with *
My Review for All EDN1 Products
Required fields are marked with *