Recombinant Human EIF6 Protein, GST-tagged
Cat.No. : | EIF6-3218H |
Product Overview : | Human EIF6 full-length ORF ( NP_002203.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-245 aa |
Description : | Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple non-protein coding transcript variants and variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2012] |
Molecular Mass : | 53 kDa |
AA Sequence : | MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ] |
Official Symbol | EIF6 |
Synonyms | EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP; B4 integrin interactor; p27 beta-4 integrin-binding protein; eukaryotic translation initiation factor 3A; CAB; EIF3A; eIF-6; ITGB4BP; p27(BBP); |
Gene ID | 3692 |
mRNA Refseq | NM_002212 |
Protein Refseq | NP_002203 |
MIM | 602912 |
UniProt ID | P56537 |
◆ Recombinant Proteins | ||
EIF6-2544C | Recombinant Chicken EIF6 | +Inquiry |
EIF6-1729R | Recombinant Rat EIF6 Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF6-5119M | Recombinant Mouse EIF6 Protein | +Inquiry |
EIF6-671H | Recombinant Human EIF6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Eif6-2794M | Recombinant Mouse Eif6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
EIF6-2911H | Recombinant Human EIF6 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF6-245HCL | Recombinant Human EIF6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF6 Products
Required fields are marked with *
My Review for All EIF6 Products
Required fields are marked with *