Recombinant Human ESR2 protein, His-tagged
Cat.No. : | ESR2-2872H |
Product Overview : | Recombinant Human ESR2 protein(Q92731)(2-323aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-323aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.8 kDa |
AA Sequence : | DIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA |
Purity : | >85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | ESR2 estrogen receptor 2 (ER beta) [ Homo sapiens ] |
Official Symbol | ESR2 |
Synonyms | ESR2; estrogen receptor 2 (ER beta); estrogen receptor beta; Erb; NR3A2; estrogen receptor beta 4; estrogen nuclear receptor beta variant a; estrogen nuclear receptor beta variant b; nuclear receptor subfamily 3 group A member 2; ESRB; ESTRB; ER-BETA; ESR-BETA; |
Gene ID | 2100 |
mRNA Refseq | NM_001040275 |
Protein Refseq | NP_001035365 |
MIM | 601663 |
UniProt ID | Q92731 |
◆ Recombinant Proteins | ||
ESR2-7H | Recombinant Human ESR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESR2-2152R | Recombinant Rat ESR2 Protein | +Inquiry |
ESR2-6357C | Recombinant Chicken ESR2 | +Inquiry |
ESR2-2867M | Recombinant Mouse ESR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ESR2-2669H | Recombinant Human ESR2 Protein (Met1-Gln530), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESR2-6539HCL | Recombinant Human ESR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESR2 Products
Required fields are marked with *
My Review for All ESR2 Products
Required fields are marked with *
0
Inquiry Basket