Recombinant Human Fibroblast Growth Factor 2 (basic) (aa 146)

Cat.No. : FGF2-678H
Product Overview : Recombinant humanFibroblast Growth Factor 2 contains 146 amino acids.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : FGF2 hasbeen hypothesized that, during both wound healing of normal tissues and tumordevelopment, the action of heparan sulfate-degrading enzymes activates bFGF,thus mediating the formation of new blood vessels, a process known asangiogenesis.
Form : Lyophilized from a0.2 um sterile filtered solution, carrier free.
Purity : >95% asdetermined by SDS-PAGE analysis.
Molecular Weight : 17 kDa
Endotoxin Level : <0.1 ng/ug ofFGF2
Biological Activity : Determined by thedose-dependent proliferation of BALB/3T3 cells. The EDSO range is 0.1-1.0ng/ml.
Specific Activity : 1.0 x 107to 1.0 x 106 units/mg
Amino Acid Sequence : PALPEDGGSGIKLQLQAEERNNYNTYRSRK AFPPGHFKDPGWSIKGVCAYTSWYVALKRKRLYCKNGGFNRYLAMKEDGTGQYKLG SKT FLR旧PDGRV RLLASKCVTDGPGQKAILFL DGVREKSDPHECFFFELESPMSAKS
Reconstitution : Centrifuge vialprior to opening. Add sterile distilled water to the vial to fully solubilizethe protein to a concentration of 0.1-0.5 mg/ml. Further dilutions should bemade in medium or buffered solution containing carrier protein such as PBSwith 0.1%BSA. Please note that the addition of any carrier protein into thisproduct may produceunwanted endotoxin.This depends upon the particular application employed.
Storage : Store at -20°C to-80°C with a carrier protein (0.1%HSA or BSA) as a stabilizer for long termstorage. Please note that the addition of any carrier protein into thisproduct may produce unwanted endotoxin. This depends upon the particularapplication employed. Avoid repeated freeze-thaw cycles.
OfficialSymbol : FGF2
Gene Name FGF2 fibroblast growth factor 2(basic) [ Homo sapiens ]
Synonyms FGF2; fibroblastgrowth factor 2 (basic); BFGF; FGFB; HBGF-2; heparin-binding growth factor 2; prostatropin;OTTHUMP00000037513; basic fibroblast growth factor bFGF
Gene ID 2247
mRNA Refseq NM_002006
Protein Refseq NP_001997
MIM 134920
UniProt ID P09038
Chromosome Location 4q26
Pathway Angiopoietinreceptor Tie2-mediated signaling; Downstreamsignaling of activated FGFR; EndochondralOssification; FGFR ligand binding andactivation; FGFR1 ligand binding andactivation; FGFR1b ligand binding andactivation; FRS2-mediated cascade;Glypican 1 network; IRS-mediated signalling; IRS-related events; Integrins in angiogenesis; MAPKsignaling pathway; Melanoma; PI-3K cascade; PI3KCascade
Function chemoattractantactivity; cytokine activity; fibroblast growth factor binding; fibroblast growthfactor receptor binding; growth factor activity; heparin binding;ligand-dependent nuclear receptor transcription coactivator activity; proteinbinding; protein tyrosine kinase activity; voltage-gated calcium channelactivity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF2 Products

Required fields are marked with *

My Review for All FGF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon