Recombinant Human FKBP5, GST-tagged
Cat.No. : | FKBP5-214H |
Product Overview : | Recombinant Human FKBP5(1 a.a. - 457 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 76.01 kDa |
AA Sequence : | MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNE PFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIR RTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGF GEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEM EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE KVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEE EKPEGHV |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FKBP5 FK506 binding protein 5 [ Homo sapiens ] |
Official Symbol | FKBP5 |
Synonyms | FKBP5; FK506 binding protein 5; P54; AIG6; FKBP51; FKBP54; PPIase; Ptg-10; MGC111006; peptidyl-prolyl cis-trans isomerase FKBP5; FKBP-5; FKBP-51; rotamase; 51 kDa FKBP; FF1 antigen; PPIase FKBP5; HSP90-binding immunophilin; T-cell FK506-binding protein; androgen-regulated protein 6; 51 kDa FK506-binding protein 5; peptidylprolyl cis-trans isomerase; 54 kDa progesterone receptor-associated immunophilin; EC 5.2.1.8; PPIase FKBP5; OTTHUMP00000016268 |
Gene ID | 2289 |
mRNA Refseq | NM_001145775 |
Protein Refseq | NP_001139247 |
MIM | 602623 |
UniProt ID | Q13451 |
Chromosome Location | 6p21.31 |
Pathway | Estrogen signaling pathway; Glucocorticoid receptor regulatory network; TNF-alpha/NF-kB Signaling Pathway |
Function | FK506 binding; heat shock protein binding; peptidyl-prolyl cis-trans isomerase activity |
◆ Recombinant Proteins | ||
FKBP5-2124H | Recombinant Human FKBP5 protein, His-tagged | +Inquiry |
FKBP5-8372H | Recombinant Human FKBP5, MYC/DDK-tagged | +Inquiry |
Fkbp5-3028M | Recombinant Mouse Fkbp5 Protein, Myc/DDK-tagged | +Inquiry |
FKBP5-214H | Recombinant Human FKBP5, GST-tagged | +Inquiry |
FKBP5-741H | Recombinant Human FKBP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP5-6204HCL | Recombinant Human FKBP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FKBP5 Products
Required fields are marked with *
My Review for All FKBP5 Products
Required fields are marked with *
0
Inquiry Basket