Recombinant Human FPR2

Cat.No. : FPR2-28948TH
Product Overview : Recombinant fragment corresponding to amino acids 163-205 of Human FPRL1 with an N terminal proprietary tag; Predicted MWt 30.36 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 43 amino acids
Description : N-formyl peptide receptor 2 is a protein that in humans is encoded by the FPR2 gene.
Molecular Weight : 30.360kDa inclusive of tags
Tissue specificity : Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name FPR2 formyl peptide receptor 2 [ Homo sapiens ]
Official Symbol FPR2
Synonyms FPR2; formyl peptide receptor 2; formyl peptide receptor like 1 , FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R;
Gene ID 2358
mRNA Refseq NM_001005738
Protein Refseq NP_001005738
MIM 136538
Uniprot ID P25090
Chromosome Location 19q13.3-q13.4
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Formyl peptide receptors bind formyl peptides and many other ligands, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function G-protein coupled receptor activity; N-formyl peptide receptor activity; receptor activity; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FPR2 Products

Required fields are marked with *

My Review for All FPR2 Products

Required fields are marked with *

0
cart-icon