Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human FPR2

Cat.No. : FPR2-28948TH
Product Overview : Recombinant fragment corresponding to amino acids 163-205 of Human FPRL1 with an N terminal proprietary tag; Predicted MWt 30.36 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : N-formyl peptide receptor 2 is a protein that in humans is encoded by the FPR2 gene.
Protein length : 43 amino acids
Molecular Weight : 30.360kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed abundantly in the lung and neutrophils. Also found in the spleen and testis.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIR
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name : FPR2 formyl peptide receptor 2 [ Homo sapiens ]
Official Symbol : FPR2
Synonyms : FPR2; formyl peptide receptor 2; formyl peptide receptor like 1 , FPRL1; N-formyl peptide receptor 2; ALXR; FMLP R II; FMLPX; FPR2A; FPRH2; HM63; LXA4R;
Gene ID : 2358
mRNA Refseq : NM_001005738
Protein Refseq : NP_001005738
MIM : 136538
Uniprot ID : P25090
Chromosome Location : 19q13.3-q13.4
Pathway : Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Formyl peptide receptors bind formyl peptides and many other ligands, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function : G-protein coupled receptor activity; N-formyl peptide receptor activity; receptor activity; signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends