Recombinant Human GCLM
Cat.No. : | GCLM-27451TH |
Product Overview : | Recombinant full length Human GCLM with N terminal proprietary tag; Predicted MWt 56.25 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 274 amino acids |
Description : | Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. |
Molecular Weight : | 56.250kDa inclusive of tags |
Tissue specificity : | In all tissues examined. Highest levels in skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHS EELHDCIQKTLNEWSSQINPDLVREFPDVLECTVSHAVEK INPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIV AIGTSDLDKTQLEQLYQWAQVKPNSNQVNLASCCVMPPDL TAFAKQFDIQLLTHNDPKELLSGASFQEALQESIPDIQAH EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS |
Sequence Similarities : | Belongs to the aldo/keto reductase family. Glutamate--cysteine ligase light chain subfamily. |
Gene Name | GCLM glutamate-cysteine ligase, modifier subunit [ Homo sapiens ] |
Official Symbol | GCLM |
Synonyms | GCLM; glutamate-cysteine ligase, modifier subunit; GLCLR; glutamate--cysteine ligase regulatory subunit; gamma glutamylcysteine synthetase; |
Gene ID | 2730 |
mRNA Refseq | NM_002061 |
Protein Refseq | NP_002052 |
MIM | 601176 |
Uniprot ID | P48507 |
Chromosome Location | 1p21 |
Pathway | Biological oxidations, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, organism-specific biosystem; Glutathione biosynthesis, glutamate => glutathione, conserved biosystem; |
Function | contributes_to glutamate-cysteine ligase activity; contributes_to glutamate-cysteine ligase activity; glutamate-cysteine ligase catalytic subunit binding; protein heterodimerization activity; |
◆ Recombinant Proteins | ||
GCLM-193HF | Recombinant Full Length Human GCLM Protein | +Inquiry |
GCLM-2493R | Recombinant Rat GCLM Protein | +Inquiry |
GCLM-1237HFL | Recombinant Full Length Human GCLM Protein, C-Flag-tagged | +Inquiry |
GCLM-974H | Recombinant Human GCLM Protein, His (Fc)-Avi-tagged | +Inquiry |
GCLM-5456H | Recombinant Human GCLM protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCLM-5982HCL | Recombinant Human GCLM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GCLM Products
Required fields are marked with *
My Review for All GCLM Products
Required fields are marked with *
0
Inquiry Basket